Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS26350 BWI76_RS26350 branched chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__Koxy:BWI76_RS26350 Length = 369 Score = 177 bits (448), Expect = 5e-49 Identities = 125/374 (33%), Positives = 188/374 (50%), Gaps = 22/374 (5%) Query: 8 TVVAAIAAAAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGVTIGGK 67 TV+A + A A +A + +K+ V +SG A +G NGAR AI+++NAQG G K Sbjct: 7 TVIAGLVALAMSQAAFAKDIKVAVVGAMSGPVAQWGDMEFNGARQAIKDINAQGGIKGDK 66 Query: 68 KIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGA 127 + E DDA DPKQ A A K+ + + V+GHL S +T PAS +Y D GI ++ Sbjct: 67 LVAVEY---DDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPG 123 Query: 128 ATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGVADVFKK 187 ATNP LT+ GY+ R D++ G A Y ++T+K + +AII D+ YG+G+A ++ Sbjct: 124 ATNPELTQRGYQYIMRTAGLDSSQGPTAAKYIMETVKPQRIAIIHDKQQYGEGLARSVQE 183 Query: 188 TATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQMEQLGMGN 247 + G +V T DF A+L +K +N D ++YGG P+ G MLRQ +G+ Sbjct: 184 SLKKGGANIVFFDGITAGEKDFSALLARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKT 243 Query: 248 VKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMP----GGTAWKAKYDAKYPNQ 303 V + G +G+ + ++ +A A AEG L MP A A DA + Sbjct: 244 V-FMGPEGVGNASLSNIAGDA--------AEG--MLVTMPKRYDQDPANSAIVDALKAEK 292 Query: 304 FQVYSPY---TYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTSTIAFEPNGEMKNP 360 PY TY A + AM RA S +P +L K V + ++ G++K Sbjct: 293 KDPSGPYVWITYAAVQSLAQAMDRAASQEPLDLIKDLKAHGAKTVIGPLNWDEKGDLKGF 352 Query: 361 AITLYV-YKDGKKT 373 ++ + DG T Sbjct: 353 EFGVFQWHADGSST 366 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 336 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 369 Length adjustment: 30 Effective length of query: 345 Effective length of database: 339 Effective search space: 116955 Effective search space used: 116955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory