Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS26365 BWI76_RS26365 branched chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__Koxy:BWI76_RS26365 Length = 372 Score = 150 bits (380), Expect = 4e-41 Identities = 94/276 (34%), Positives = 144/276 (52%), Gaps = 8/276 (2%) Query: 1 MQLKLKLTVVAAIAAA-AGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNA 59 M +K K + IA +G A A++ +K+ V +SG A YG GA AI ++NA Sbjct: 6 MNMKGKALLAGCIALIMSGTAMAED--IKVAVVGAMSGPVAQYGDQEFTGAEQAIADINA 63 Query: 60 QGVTIGGKKIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDC 119 +G G K K ++V DDA DPKQ A A K+ + + V+GHL S +T PAS +Y D Sbjct: 64 KG---GIKGNKLQMVKYDDACDPKQAVAVANKVINDGIKYVIGHLCSSSTQPASDIYEDE 120 Query: 120 GIPHVTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQ 179 G+ +T AAT P LT GY R D+ G A Y ++ +K + +AI+ D+ YG+ Sbjct: 121 GVLMITPAATAPELTARGYHLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGE 180 Query: 180 GVADVFKKTATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQ 239 G+A + G VV T DF ++ +K +N D ++YGG P+ G +LRQ Sbjct: 181 GLARAVQDNLKKGGANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQ 240 Query: 240 MEQLGMGNVKYFGGDGICTSEIAKLAAGAKTLGNVI 275 G+ ++ G +G+ ++ + AGA G ++ Sbjct: 241 SRAAGL-KTQFMGPEGVANVSLSNI-AGASAEGMLV 274 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 372 Length adjustment: 30 Effective length of query: 345 Effective length of database: 342 Effective search space: 117990 Effective search space used: 117990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory