Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate BWI76_RS22880 BWI76_RS22880 L-serine ammonia-lyase
Query= uniprot:P33073 (292 letters) >FitnessBrowser__Koxy:BWI76_RS22880 Length = 455 Score = 132 bits (331), Expect = 2e-35 Identities = 96/274 (35%), Positives = 144/274 (52%), Gaps = 16/274 (5%) Query: 12 CNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVTEYKMI--- 68 C E G+ + L+++ E+ + ++E + + AV +VM + + +T V K+ Sbjct: 181 CRESGLSLSGLMMQNEL--ALHSKEALEQHFAAVWEVMSSGIERGITTEGVLPGKLRVPR 238 Query: 69 DGFAKR----TYEYANSGKSIVGDFLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGIMPA 124 A R + + NS V D++ A + +E NA+ G++V APT G+ GI+PA Sbjct: 239 RAAALRRMLVSQDNTNSDPMAVVDWINM---FALAVNEENAAGGRVVTAPTNGACGIVPA 295 Query: 125 MLVAATEKY--NFDRTTIQNGFLTSIGIGQVITKYATFAGAEGGCQAECGSASAMAAAAL 182 +L A +K+ + ++ L + IG + A+ +GAE GCQ E G A +MAAA L Sbjct: 296 VL-AYYDKFIRKVNANSLARYMLVTSAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGL 354 Query: 183 VEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFISADLALAGV 242 E+LGG+ Q AA I + + LGL CDP+AG VQ PC RNA + A +A +AL Sbjct: 355 AELLGGSPGQVCIAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRT 414 Query: 243 -ESLVPFDEVVIAMGEVGNSMIEALRETGLGGLA 275 E V D+V+ M E G M RET GGLA Sbjct: 415 SEPRVCLDKVIETMYETGKDMNAKYRETSRGGLA 448 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 455 Length adjustment: 29 Effective length of query: 263 Effective length of database: 426 Effective search space: 112038 Effective search space used: 112038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory