Align Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized)
to candidate BWI76_RS02700 BWI76_RS02700 D-serine/D-alanine/glycine transporter
Query= TCDB::F2HQ24 (457 letters) >FitnessBrowser__Koxy:BWI76_RS02700 Length = 467 Score = 348 bits (894), Expect = e-100 Identities = 184/437 (42%), Positives = 271/437 (62%), Gaps = 6/437 (1%) Query: 13 QRGLKNRHIQLIAIAGTIGTGLFLGAGKSIHLTGPSIIFVYLIIGALMYILLRAIGEMLY 72 +R L NRHIQLIAI G IGTGLF+G+GK+I L GPSIIFVY+IIG +++ ++RA+GE+L Sbjct: 20 RRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLL 79 Query: 73 QDPNQHSFLNFVSRYLGEKPGYFIQWSYLLVVVFVAMAELIAIGTYINFWLPDLPIWMTE 132 + SF +F + LG GYF W+Y V MA+++AI Y FW P L W+ Sbjct: 80 SNLEYKSFSDFAADLLGPWAGYFTGWTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVAS 139 Query: 133 VFVLVLLTLLNTLNPKFFGETEFWFGMIKIVAIIGLILTAIILIFSHYHTGTDT-VSVTN 191 + V++LL LN K FGE EFWF MIKIVAI+ LI+ ++++ H+ + T S + Sbjct: 140 LAVILLLLGLNLATVKMFGEMEFWFAMIKIVAIVALIVVGLVMVMMHFQSPTGVEASFAH 199 Query: 192 ITKGFEFFPNGLSNFFESFQMVMFAFVSMEFIGMTAAETDNPRPTLKKAINQIPIRIVLF 251 + +FP G+S FF FQ+ +FAFV +E +G TAAET +P +L +AIN IPIRI++F Sbjct: 200 LWNDGGWFPKGISGFFAGFQIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPIRIIMF 259 Query: 252 YVGALLAIMSIYQWRDIPADKSPFVTIFQLIGIKWAAALVNFVVLTSAASALNSALFSIT 311 YV AL+ IMS+ W + KSPFV +F L+G+ AA+L+NFVVLTSAAS+ NS +FS + Sbjct: 260 YVFALIVIMSVTPWSSVVPSKSPFVELFVLVGLPAAASLINFVVLTSAASSANSGVFSTS 319 Query: 312 RNLYSLSKLNNDKILKPFTKFSKAGVPVNALLFTSLLILFTPFISMI-PAISNSFVFITS 370 R L+ L++ + + K F K SK VP L F+ + +L + M+ P++ +F IT+ Sbjct: 320 RMLFGLAQ--DGQAPKMFAKLSKRAVPAKGLTFSCMCLLGGVVMLMVNPSVIAAFTMITT 377 Query: 371 VATNLFLVVYLMTLITYLKYRKSSD--FDPKGFVLPAAHIFIPLAIAGFVLIFISLFCFK 428 V+ LF+ V+ + L +YL YRK + + +P + + +A F + + L Sbjct: 378 VSAILFMFVWTIILCSYLVYRKKRPQLHEQSKYKMPLGKLMCWVCMAFFAFVLVLLTLEA 437 Query: 429 DTIVPAIGSVIWVLIFG 445 DT + + +W ++ G Sbjct: 438 DTREALMVTPLWFVLLG 454 Lambda K H 0.330 0.144 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 467 Length adjustment: 33 Effective length of query: 424 Effective length of database: 434 Effective search space: 184016 Effective search space used: 184016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory