Align Sorbitol (D-Glucitol):H+ co-transporter, SOT1 (Km for sorbitol of 0.64 mM) of 509 aas and 12 TMSs (Gao et al. 2003). SOT1 of P. cerasus is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves (characterized)
to candidate BWI76_RS17580 BWI76_RS17580 MFS transporter
Query= TCDB::AIU41385.1 (509 letters) >FitnessBrowser__Koxy:BWI76_RS17580 Length = 479 Score = 200 bits (508), Expect = 1e-55 Identities = 140/474 (29%), Positives = 236/474 (49%), Gaps = 27/474 (5%) Query: 17 LKKKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQEDLKISDVEVEILIGILNLY 76 L + ++ L+ I ++A+ +L GYD GV++GA +++ + ++ +++ +L + Sbjct: 7 LNLQQRKRLHQI--TLVATFGGLLFGYDTGVINGAFSSLKQYMALTPTTEGLVMSVLLIG 64 Query: 77 SLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALM 136 + +GS G+ +D+ GRR ++F IFF GAL+ A + L++ RF+ G VG A + Sbjct: 65 AALGSVFGGKFADFFGRRKYLLFLSFIFFIGALMSALAPDITVLLISRFILGYAVGGASV 124 Query: 137 IAPVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPINLG--WRLMLGVGVF 194 AP + +EV+P RG LT EV + IG L + N L +L WR ML V Sbjct: 125 TAPTFISEVAPTEMRGKLTGLNEVAIVIGQLAAFAINAIIGILWGHLPDVWRYMLMVQTI 184 Query: 195 PSVILAVGVLTMPESPRWLVMQGRLGDAKHVLDKTSDSLEEAQLRLADIKEAAGIPEHCT 254 P++ L +G+L PESPRWL+ + R +A +L K LE A DI T Sbjct: 185 PAICLFIGMLRSPESPRWLISKNRHEEALEIL-KQIRPLERATKEFNDI---------TT 234 Query: 255 EDVVQVPKHSHGEEVWKELLLHPTPPVRHILIAAVGFHFFQQMSGIDALVLYSPRIFRAS 314 + K H + + +L TP + +L+ V + QQ +G++ ++ Y I ++ Sbjct: 235 LIKAEADKKLHSQNAFITIL--QTPWIFKLLLVGVIWAALQQTTGVNVIMYYGTEILSSA 292 Query: 315 GITDSSTLLLATVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIA-SLLCLGTSLTI 373 G ++ ++L+ + FS + +DR R+ +++ A M L+ G T+ Sbjct: 293 GFSERTSLICNVLNGVFSVGGMLFGVLFLVDRFKRKTIIIYGFALMATLHLIIAGVDYTL 352 Query: 374 VDHEKEKMMWASVVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAV--N 431 V K +W + +VG MG I WV +E+FPLK R G SMG +V Sbjct: 353 VGDIKATAIW------LLGAMFVGVMQGTMGFITWVVLAELFPLKFR--GLSMGISVFFM 404 Query: 432 RIMSGVLTMTFITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDME 485 +M+ +++ F L + +G F ++ AI + VF T LPET ++LE +E Sbjct: 405 WVMNAIVSYLFPLLQAKLGLGPVFLIFAAINYLAIVFVITALPETSNKSLEQLE 458 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 652 Number of extensions: 41 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 479 Length adjustment: 34 Effective length of query: 475 Effective length of database: 445 Effective search space: 211375 Effective search space used: 211375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory