Align ABC transporter for D-Sorbitol, permease component 2 (characterized)
to candidate BWI76_RS03135 BWI76_RS03135 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2943 (316 letters) >FitnessBrowser__Koxy:BWI76_RS03135 Length = 290 Score = 98.2 bits (243), Expect = 2e-25 Identities = 84/286 (29%), Positives = 138/286 (48%), Gaps = 13/286 (4%) Query: 30 MNRRLLPRLLLTPAMATLFLWMIVPLVMTIYFSLIRYNLMQPDQTGFAGLENFEFFVTDP 89 M + LP L+L+P++ L L+ PL ++Y SL ++ D + GLENF D Sbjct: 1 MRKTWLPWLILSPSLLFLLLFTWFPLGRSVYDSLFDTRMVS-DGGQYVGLENFSRLFADS 59 Query: 90 SFGTAVVNTILLLGSVILITVVLGVAIALLINEPFPGRGIVRVLLISPFF---VMPTVNA 146 F ++VN +L IL+TVV GV +ALL+ V L + FF ++P V+A Sbjct: 60 VFWQSLVNNLLY----ILLTVVPGVTLALLLAVALTENHRVNRWLRTAFFFPMIIPMVSA 115 Query: 147 LMWKNMMMNPIYGVLAQVWI-FFGAAPVDWL--TDHPLFSVIVMVSWQWLPFATLIFMTA 203 + P G+L FG +WL ++ L ++ ++ W++ + L F+ Sbjct: 116 AALWLFIFMPGLGLLDHYLAKLFGPMNNNWLGRSNSALLALALIGVWKFAGYYMLFFLAG 175 Query: 204 LQSMNHEQLEASRMDGANYLQQLRYLYVPHLGRSVAVVVMIELIFLLSIFAEIYTTTAGG 263 LQS+ EA+ M+GA Q + +P L +++ V+ LI+ ++ + T GG Sbjct: 176 LQSIPASTREAAIMEGATRTQVFFKVTLPLLRPTLSFVITTALIYSITQIDHVAVMTRGG 235 Query: 264 PGDASTNVTFLIFKQALLNFDAGVASAGALFAVVLANIAAVFLIRM 309 P +A+T + + I A D G ASA + LA + A LI + Sbjct: 236 PDNATTVLLYYIQNLAWDTHDLGKASAATF--LTLAGLFAFSLINL 279 Lambda K H 0.331 0.142 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 290 Length adjustment: 27 Effective length of query: 289 Effective length of database: 263 Effective search space: 76007 Effective search space used: 76007 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory