Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate BWI76_RS17175 BWI76_RS17175 6-phosphofructokinase II
Query= curated2:P23354 (318 letters) >FitnessBrowser__Koxy:BWI76_RS17175 Length = 310 Score = 118 bits (295), Expect = 2e-31 Identities = 89/281 (31%), Positives = 132/281 (46%), Gaps = 6/281 (2%) Query: 7 TVTLNPAIDQTIQLDRLQPGAVHRASSVRNDAGGKGINVAACLADWGSQVAALGVLGVGN 66 T+TL P++D Q ++ P R S+ + GG GINVA + G A+ +G Sbjct: 6 TLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGSATAIFPVGGAT 65 Query: 67 AGVFEALFRERGITDHCHRVAGDTRTNLKLVEAQVNETTDINLPGLQLGQAHLQGVADHL 126 AL + + TR NL + E +PG L L+ + + + Sbjct: 66 GEHLTALLTDEHVPVDTVETHDWTRQNLHVHVNASGEQYRFVMPGAALTADELRLIEEKV 125 Query: 127 APLLRAGLPVVLSGSLPAGLPEDSWAQLQAQASAAGARVLLDTSGAPLVAALAAAPVAMP 186 + L +V+SGSLP G+ ++ QL A G R ++D+SG L AAL + + Sbjct: 126 LTIAPGSL-LVISGSLPPGISVENLTQLVKNAQRHGLRCIVDSSGDALAAALDVGNIEL- 183 Query: 187 YAVKPNRHELEAWTGHPLGDHAALTAAAHALIARG-IQLVVISMGTEGALFVQRDQQLIA 245 VKPN+ EL A L + AA LI G +Q VV+S+G +GAL V D + Sbjct: 184 --VKPNQKELSALVQRDLSQPDDVRLAAQELIRSGKVQRVVVSLGAQGALGVDADGSVQV 241 Query: 246 RPPRLAQGSSVGAGDAMVAGLAAALLDDATELEQCARLATA 286 PP + S+VGAGD+MV + L ++A+ LE R A Sbjct: 242 VPPPMKSQSTVGAGDSMVGAMTLRLAENAS-LEDMVRFGVA 281 Lambda K H 0.318 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 310 Length adjustment: 27 Effective length of query: 291 Effective length of database: 283 Effective search space: 82353 Effective search space used: 82353 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory