Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate BWI76_RS24860 BWI76_RS24860 1-phosphofructokinase
Query= curated2:O31714 (303 letters) >FitnessBrowser__Koxy:BWI76_RS24860 Length = 304 Score = 174 bits (440), Expect = 3e-48 Identities = 96/304 (31%), Positives = 166/304 (54%), Gaps = 1/304 (0%) Query: 1 MIYTVTLNPSVDYIVHVEDFTVGGLNRSSYDTKYPGGKGINVSRLLKRHHVASKALGFVG 60 MI+T+TLN ++D + + +NR+ + P GKG+NVS +L + + +G G Sbjct: 1 MIHTLTLNTAIDMNIFCDPLKPSAVNRTRHTEYCPNGKGVNVSLILNHYQQPTHIIGIFG 60 Query: 61 GFTGEYIKTFLREENLETAFSEVKGDTRINVKLKTG-DETEINGQGPTISDEDFKAFLEQ 119 GFTG YI LR++ ++ + V TRIN+ + G +E ++ G I DE + + Sbjct: 61 GFTGRYIVEELRQKKIKVTPAWVSEPTRINIFINDGAEEYKLVNPGAKIDDECKQQVIHH 120 Query: 120 FQSLQEGDIVVLAGSIPSSLPHDTYEKIAEACKQQNARVVLDISGEALLKATEMKPFLMK 179 Q + GD + ++GS+P + Y +I E C+Q+ V+LDIS L + E++P L+K Sbjct: 121 LQCVASGDYLAISGSLPPGIESRFYAEIIELCQQKRCEVILDISHPVLRQLLELRPLLIK 180 Query: 180 PNHHELGEMFGTAITSVEEAVPYGKKLVEQGAEHVIVSMAGDGALLFTNEAVYFANVPKG 239 PN EL E+FG +++ ++ + L + GA +V+++M +G E V+F + PK Sbjct: 181 PNDDELREIFGLDVSNHQQVREAMRTLHQLGARNVLLTMGAEGLYFSDGEGVWFCSAPKI 240 Query: 240 KLVNSVGAGDSVVAGFLAGISKQLPLEEAFRLGVTSGSATAFSEELGTEEFVQQLLPEVK 299 LV+S AGD+ + FL+ + + A L +G+ A S LG + ++LL +++ Sbjct: 241 ALVSSACAGDAALGAFLSKWLNKEDVAHALALASATGADVAGSAGLGKLQRTEELLQQIQ 300 Query: 300 VTRL 303 V +L Sbjct: 301 VVQL 304 Lambda K H 0.315 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 304 Length adjustment: 27 Effective length of query: 276 Effective length of database: 277 Effective search space: 76452 Effective search space used: 76452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS24860 BWI76_RS24860 (1-phosphofructokinase)
to HMM TIGR03828 (pfkB: 1-phosphofructokinase (EC 2.7.1.56))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03828.hmm # target sequence database: /tmp/gapView.15451.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03828 [M=305] Accession: TIGR03828 Description: pfkB: 1-phosphofructokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-100 322.3 0.0 1.5e-100 322.1 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS24860 BWI76_RS24860 1-phosphofructokin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS24860 BWI76_RS24860 1-phosphofructokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 322.1 0.0 1.5e-100 1.5e-100 1 304 [. 2 301 .. 2 302 .. 0.99 Alignments for each domain: == domain 1 score: 322.1 bits; conditional E-value: 1.5e-100 TIGR03828 1 IlTvTlNpaiDktieleelelgevnrveserldagGKGinVarvLkklgvevvalgflGgftgeeiealle 71 I T+TlN+aiD+ i + l++ +vnr+++++++++GKG+nV+ +L++ +++++++g++Ggftg++i ++l+ lcl|FitnessBrowser__Koxy:BWI76_RS24860 2 IHTLTLNTAIDMNIFCDPLKPSAVNRTRHTEYCPNGKGVNVSLILNHYQQPTHIIGIFGGFTGRYIVEELR 72 88********************************************************************* PP TIGR03828 72 eegiktdfvevkgetRinvkikessgeetklnepGpeiseeeleallekleeqlkegdvlvlaGSlPrgvp 142 +++ik+++ +v++ tRin++i++ ee+kl++pG++i++e++++++++l+ +++gd+l ++GSlP+g++ lcl|FitnessBrowser__Koxy:BWI76_RS24860 73 QKKIKVTPAWVSEPTRINIFIND-GAEEYKLVNPGAKIDDECKQQVIHHLQ-CVASGDYLAISGSLPPGIE 141 **********************8.9**************************.9****************** PP TIGR03828 143 edlyaelikllrekgakvilDtsgeaLlkvlkakplliKPNkeEleellgrelkteeevieaarkllekgv 213 +++yae+i+l+++k +vilD+s+++L++ l+ +plliKPN++El e++g +++++++v ea+r+l++ g+ lcl|FitnessBrowser__Koxy:BWI76_RS24860 142 SRFYAEIIELCQQKRCEVILDISHPVLRQLLELRPLLIKPNDDELREIFGLDVSNHQQVREAMRTLHQLGA 212 *********************************************************************** PP TIGR03828 214 envlislGadGallvtkegalfakapkievkstvGAGDsmvAgfllalekglsleealrlavAvgaaaass 284 +nvl+++Ga+G ++ + eg++f++apki ++s+++AGD+++++fl+++ +++++++al+la A+ga++a s lcl|FitnessBrowser__Koxy:BWI76_RS24860 213 RNVLLTMGAEGLYFSDGEGVWFCSAPKIALVSSACAGDAALGAFLSKWLNKEDVAHALALASATGADVAGS 283 *********************************************************************** PP TIGR03828 285 egtelpdledieelleevki 304 +g l++l++ eell+++++ lcl|FitnessBrowser__Koxy:BWI76_RS24860 284 AG--LGKLQRTEELLQQIQV 301 **..**************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (305 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory