Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate BWI76_RS07245 BWI76_RS07245 ABC transporter
Query= uniprot:A0A0C4Y7K0 (337 letters) >FitnessBrowser__Koxy:BWI76_RS07245 Length = 343 Score = 201 bits (511), Expect = 2e-56 Identities = 125/317 (39%), Positives = 181/317 (57%), Gaps = 32/317 (10%) Query: 39 LVLLCIGFSVLTENFAGW-----------QNLSIIAQQASINMVLAAGMTFVILTGGIDL 87 +V+L I LT AGW L +I Q +I ++A G+T VI+T GIDL Sbjct: 33 IVMLVIA---LTFEIAGWYVRDQSFLLNTNRLILIVLQVAIIGIIAVGVTQVIITTGIDL 89 Query: 88 SVGSILSISAVVA------------MLVSLMPQLGMLSVPAALLCGLLFGIVNGALVAFM 135 S GS+++++AVVA M SL+ ++ + A + GLL G+ NG LV Sbjct: 90 SSGSVIALAAVVAASLAQTSDSLSPMFPSLVNMPAIIPIGAGIGVGLLCGLTNGFLVTRT 149 Query: 136 KLPPFIVTLGTLTAVRGLARLVGNDSTIYNPDIGFAFIGNGEVLGVPWLVIIAFAVVAVS 195 +PPFI TLG + + RGLA+ + I F IG G + VII F V AV Sbjct: 150 GIPPFIATLGMMVSARGLAQYYTQGNPISFLSDSFTAIGQGAMP-----VIIFFVVAAVF 204 Query: 196 WFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAAN 255 L+ T G +YA+GGN +A++SGI V L+ VYA++G L+GL GV+ +AR+ + Sbjct: 205 HIALKHTRYGKYVYAIGGNMTSAKVSGINVNKYLVIVYAIAGALSGLAGVVLAARVSSGQ 264 Query: 256 GLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYII 315 +G SYELDAIAA ++GG+S +GG G I GTL+GA+I+ ++ +G +GV Q II Sbjct: 265 S-SMGMSYELDAIAAAVIGGSSLMGGVGRITGTLIGAMILGLIKSGFTFVGVDAYVQDII 323 Query: 316 KGLVIIGAVALDSYRRK 332 KG++I+ AV +D R + Sbjct: 324 KGIIIVAAVTIDMRRNR 340 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 343 Length adjustment: 28 Effective length of query: 309 Effective length of database: 315 Effective search space: 97335 Effective search space used: 97335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory