Align Phosphotransferase system IIB component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate BWI76_RS19725 BWI76_RS19725 PTS fructose transporter subunit EIIBC
Query= TCDB::Q5V5X1 (143 letters) >FitnessBrowser__Koxy:BWI76_RS19725 Length = 558 Score = 80.5 bits (197), Expect = 4e-20 Identities = 44/117 (37%), Positives = 71/117 (60%), Gaps = 5/117 (4%) Query: 2 KLVAVTSCPTGIAHSQMAAENLEQTAEEQGHDIKVEVQGAMGAENELSDSDIEAADAAII 61 ++VAVT+CPTG+AH+ MAAE +E A+++G +KVE +G++GA N ++ ++E AD ++ Sbjct: 105 RIVAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVEQADLVVV 164 Query: 62 ASDTSVSQDRFSGVPLIDGTVKDAVNDAEGMIADAVKAADGDTPARETDVGSSEASA 118 A+D V +F+G P+ T A+ + AV A PA G S+A+A Sbjct: 165 AADIEVDLAKFAGKPMYRTTTGLALKKTAQELDKAVVEAKPYQPA-----GKSQAAA 216 Lambda K H 0.308 0.124 0.328 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 143 Length of database: 558 Length adjustment: 25 Effective length of query: 118 Effective length of database: 533 Effective search space: 62894 Effective search space used: 62894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory