Align Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate BWI76_RS19725 BWI76_RS19725 PTS fructose transporter subunit EIIBC
Query= TCDB::Q5V5X5 (383 letters) >FitnessBrowser__Koxy:BWI76_RS19725 Length = 558 Score = 279 bits (714), Expect = 1e-79 Identities = 150/342 (43%), Positives = 222/342 (64%), Gaps = 24/342 (7%) Query: 26 LMTGVSFMIPFVTIGGIFLAVAYAIGDTQAVFENTGSAGWFLAQIGV-AGLTIMVPILGG 84 L+TGVS+M+P V GG+ +A+++A G ++T +A L QIG + +MVP+L G Sbjct: 229 LLTGVSYMLPMVVAGGLCIALSFAFGIKAFEVKDTLAAA--LMQIGGGSAFALMVPVLAG 286 Query: 85 YIAYAIADRPGLAPGFLLAYILQQGNVVAEAATVIGISGGEAGAGYLGAIVAGLLAGYVA 144 +IA++IADRPGL PG + G ++A + G+G++G I+AG LAGYVA Sbjct: 287 FIAFSIADRPGLTPGLI-------GGMLAVST----------GSGFIGGIIAGFLAGYVA 329 Query: 145 RFFKN-LDVPEFIQPMMPVLLIPVATMAVLTPIMLFVLGVPVALANEGLTSFLQSMQGGQ 203 + L +P+ ++ + P+L+IP+ + ++ M++++G PVA EGLT +LQ+M Sbjct: 330 KAISTKLKLPQSMEALKPILIIPLVSSLIVGLAMIYLIGKPVAGILEGLTHWLQTMGTAN 389 Query: 204 AIVVGLILGGMMAFDMGGPVNKVAYVFATGLITEEIYAPMAAVMIGGMIPPIGLALSNFI 263 A+++G ILGGMM DMGGPVNK AY F GL++ + YAPMAA+M GM+PP+ L L+ I Sbjct: 390 AVLLGAILGGMMCTDMGGPVNKAAYAFGVGLLSTQTYAPMAAIMAAGMVPPLALGLATLI 449 Query: 264 APHKYAAEMYENGKSGVVLGLSFITEGAIPYAAADPLRVIPAIVAGSAVGGATSMALGVT 323 A K+ E GK+ +VLGL FITEGAIP+AA DP+RV+P + G AV GA SM +G Sbjct: 450 ARKKFDKAQQEGGKAALVLGLCFITEGAIPFAARDPMRVLPCCIVGGAVTGAMSMWVGAK 509 Query: 324 MPAPHGGIFVVLLS---NQPLAFLGSILLGSLVTAVVATVIK 362 + APHGG+FV+L+ L +L +I++G+LV + V+K Sbjct: 510 LMAPHGGLFVLLIPGAITPVLGYLMAIVVGTLVAGLSYAVLK 551 Lambda K H 0.322 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 780 Number of extensions: 55 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 558 Length adjustment: 33 Effective length of query: 350 Effective length of database: 525 Effective search space: 183750 Effective search space used: 183750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory