Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate BWI76_RS22920 BWI76_RS22920 MFS transporter
Query= uniprot:A0A1I2JXG1 (442 letters) >FitnessBrowser__Koxy:BWI76_RS22920 Length = 436 Score = 266 bits (681), Expect = 7e-76 Identities = 154/412 (37%), Positives = 234/412 (56%), Gaps = 6/412 (1%) Query: 25 YPMAMGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAGL 84 Y + +L S+FF+W LNDIL+P + F L +A L+Q F+ YF++ +PAG+ Sbjct: 22 YIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFVIPIPAGI 81 Query: 85 LVARLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYVA 144 L+ +L YK GI+ GL + GAA FWPAA + Y FL LF++A G+ L+ AAN +V Sbjct: 82 LMKKLSYKAGIITGLFLYAFGAALFWPAAEVMNYTLFLIGLFIIAAGLGCLETAANPFVT 141 Query: 145 LLGPEKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSAEQIA-KLSPAEQVAYRVQ 203 +LGPE RL LAQ NS G +A FG LILS ++ + K++P + AY+ Sbjct: 142 VLGPESGGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMAPEQLSAYKHS 201 Query: 204 EAQTVQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQASVKQH---SLVSPLRHPHVLFG 260 +VQ PY+ + V+ L+A+ + L + PAL + + SL +R H + Sbjct: 202 LVLSVQTPYMIIVAVVLLVALLIMLTKFPALQSDDHSDATQSSFSASLARLVRVRHWRWA 261 Query: 261 VLAIFFYVGGEVAIGSFLVNYLSMPDIGNMSEQAAANWVAYYWLGAMIGRFIGSALLAKL 320 VLA F YVG + A S+L+ Y ++ +I M+ AAN++ + IGRF G+ L+++ Sbjct: 262 VLAQFCYVGAQTACWSYLIRY-AIEEIPGMTPGFAANYLTGTMVCFFIGRFSGTWLISRF 320 Query: 321 SPRKLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERMGPMTGE 380 +P K+LA +A ++M L L + T G V + ++ F SI +PTIFSLGI+ +G T Sbjct: 321 APHKVLAAYALLSMILCLISAFTGGHVGLLALTLCSAFMSIQYPTIFSLGIKNLGQDTKY 380 Query: 381 ASSLLIMAIVGGAIVPFVQGLFADHIG-VQHAFFLPLLCYAYIVFYGLYGSR 431 SS ++M I+GG IV V G +D G + A +P LC+A I + + S+ Sbjct: 381 GSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELVPALCFAVIFIFARFRSQ 432 Lambda K H 0.327 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 436 Length adjustment: 32 Effective length of query: 410 Effective length of database: 404 Effective search space: 165640 Effective search space used: 165640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory