Align UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9 (characterized)
to candidate BWI76_RS17270 BWI76_RS17270 UTP--glucose-1-phosphate uridylyltransferase
Query= CharProtDB::CH_021667 (302 letters) >FitnessBrowser__Koxy:BWI76_RS17270 Length = 300 Score = 562 bits (1448), Expect = e-165 Identities = 279/296 (94%), Positives = 290/296 (97%) Query: 1 MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 60 MAA+N+KV+KAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV Sbjct: 1 MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV 60 Query: 61 THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL 120 THSSKNSIENHFDTSFELEAMLEKRVKRQLL+EVQSICPPHVTIMQVRQGLAKGLGHAVL Sbjct: 61 THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL 120 Query: 121 CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV 180 CAHPVVGDEPVAVILPDVILDEYESDLS+DNLAEM+ RFDETG SQIMVEPVADVTAYGV Sbjct: 121 CAHPVVGDEPVAVILPDVILDEYESDLSRDNLAEMMARFDETGASQIMVEPVADVTAYGV 180 Query: 181 VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ 240 VDCKG+ L PGESVPMVGVVEKPKADVAPSNLA+VGRYVLSADIWPLLAKTPPGAGDEIQ Sbjct: 181 VDCKGLALQPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ 240 Query: 241 LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEE 296 LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYG+RH +LG EFKAWLE+ Sbjct: 241 LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGVRHKSLGEEFKAWLEK 296 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 300 Length adjustment: 27 Effective length of query: 275 Effective length of database: 273 Effective search space: 75075 Effective search space used: 75075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS17270 BWI76_RS17270 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.1801.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-119 383.5 0.1 3.1e-119 383.3 0.1 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS17270 BWI76_RS17270 UTP--glucose-1-pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS17270 BWI76_RS17270 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 383.3 0.1 3.1e-119 3.1e-119 1 261 [] 8 275 .. 8 275 .. 0.98 Alignments for each domain: == domain 1 score: 383.3 bits; conditional E-value: 3.1e-119 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyel 71 +rkaviP+aGlGtr+LPatkaiPkemlp+vdkPliqyvv+e+++aGi+eivlvt++sk++ie+hfDts+el lcl|FitnessBrowser__Koxy:BWI76_RS17270 8 VRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTSFEL 78 79********************************************************************* PP TIGR01099 72 eaklekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee.... 137 ea+lek+ k++ll+ev++i++ +ti++vrq akGLGhavl+a+++vgdep+av+l+D++++e e+ lcl|FitnessBrowser__Koxy:BWI76_RS17270 79 EAMLEKRVKRQLLEEVQSICPPhVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESdlsr 149 ********************988*****************************************9998999 PP TIGR01099 138 .alkqlielyektgasiiaveevpkeevskYGvidgeeveeelye...vkdlvekPkpeeapsnlaivGrY 204 +l+++++++++tgas+i+ve v+ +v++YGv+d++++ + e + +vekPk++ apsnla+vGrY lcl|FitnessBrowser__Koxy:BWI76_RS17270 150 dNLAEMMARFDETGASQIMVEPVA--DVTAYGVVDCKGLALQPGEsvpMVGVVEKPKADVAPSNLAVVGRY 218 99*********************9..9***********887776666699********************* PP TIGR01099 205 vltpeifelleetkaGkggeiqltDalrlllekeevlavklkgkryDvGdklgylka 261 vl+++i+ ll++t++G+g+eiqltDa+++l+eke+v+a+++kgk++D+G+klgy++a lcl|FitnessBrowser__Koxy:BWI76_RS17270 219 VLSADIWPLLAKTPPGAGDEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQA 275 *******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (300 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.30 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory