Align UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9; Alpha-D-glucosyl-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase (uncharacterized)
to candidate BWI76_RS19105 BWI76_RS19105 GalU regulator GalF
Query= curated2:Q48447 (298 letters) >FitnessBrowser__Koxy:BWI76_RS19105 Length = 298 Score = 546 bits (1407), Expect = e-160 Identities = 274/298 (91%), Positives = 288/298 (96%) Query: 1 MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS 60 M M +LKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPM+QYIVDEIVAAGIKEIVLVTHS Sbjct: 1 MKMVSLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMVQYIVDEIVAAGIKEIVLVTHS 60 Query: 61 SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR 120 SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQ Q LGLGHSILCAR Sbjct: 61 SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQGQQLGLGHSILCAR 120 Query: 121 PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQ 180 P++GDNPFVVVLPDIILD +ADPLRYNLAAM+ARFNETGRSQVLAKRM GDLSEYSVIQ Sbjct: 121 PLIGDNPFVVVLPDIILDDASADPLRYNLAAMVARFNETGRSQVLAKRMEGDLSEYSVIQ 180 Query: 181 TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQL 240 TK+P+ + GQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSAD+W+ELERTEPGAWGRIQL Sbjct: 181 TKDPLESAGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADVWSELERTEPGAWGRIQL 240 Query: 241 TDAIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGAKFRESIKKLLA 298 TDAIAELAKKQSVDAMLMTG+SYDCGKKMGYMQAFV+YG+RN KEGAKFRESIKKLLA Sbjct: 241 TDAIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVSYGLRNHKEGAKFRESIKKLLA 298 Lambda K H 0.319 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 298 Length adjustment: 27 Effective length of query: 271 Effective length of database: 271 Effective search space: 73441 Effective search space used: 73441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory