Align PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 (characterized)
to candidate BWI76_RS01735 BWI76_RS01735 PTS mannose/fructose/sorbose family transporter subunit IIB
Query= SwissProt::P26380 (163 letters) >FitnessBrowser__Koxy:BWI76_RS01735 Length = 164 Score = 148 bits (374), Expect = 4e-41 Identities = 69/150 (46%), Positives = 102/150 (68%) Query: 2 MNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASAV 61 MNI LARIDDR IHGQ+ T W KV A RII+ +DD+ D++R+TL+ AP +K + V Sbjct: 1 MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDDVRRTLLRQAAPPGMKVNVV 60 Query: 62 SVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSV 121 ++ K +H+P+Y+ T LF NP D++++++ GV I T+N+GGM + ++Q+TK+V Sbjct: 61 NLEKAVAVYHNPQYQDETVFYLFTNPQDVLTMVQQGVNIATLNIGGMAWRPGKKQLTKAV 120 Query: 122 SVTEQDIKAFETLSDKGVKLELRQLPSDAS 151 S+ E DI AF+ L GV L+LR + SD S Sbjct: 121 SLDEADINAFQQLDKLGVNLDLRVVASDPS 150 Lambda K H 0.320 0.133 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 80 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 164 Length adjustment: 18 Effective length of query: 145 Effective length of database: 146 Effective search space: 21170 Effective search space used: 21170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory