Align fructokinase; EC 2.7.1.4 (characterized)
to candidate BWI76_RS14875 BWI76_RS14875 ribokinase-like domain-containing protein
Query= CharProtDB::CH_006620 (326 letters) >FitnessBrowser__Koxy:BWI76_RS14875 Length = 314 Score = 307 bits (787), Expect = 2e-88 Identities = 154/283 (54%), Positives = 194/283 (68%) Query: 1 MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIPTAFFTGIADDMMGEI 60 MILCCGEALIDMLP + + F P GGA FNTA+ALGR G+ + F+G++DD MG++ Sbjct: 1 MILCCGEALIDMLPCQSRENDPAFTPCVGGAAFNTAVALGRQGMAVSLFSGLSDDFMGDM 60 Query: 61 LLETLKASNVDYSPCAITPRPSTIAFVKLVNGQATYAFYDEGTAGRMITTADLPDLGDDC 120 L TL AS VDYSP P P+T+AFV+LV GQA Y FYDE +AGRM+ +DLP+L DD Sbjct: 61 LRHTLDASGVDYSPSTRAPLPTTLAFVRLVGGQARYTFYDENSAGRMLRESDLPELRDDV 120 Query: 121 EALHFGAISLIPSPCGETYEALLDREAASRVISLDPNIRPGFIKDKPSHMARIKRMAAKS 180 A+ FG ISLI PCG YE L+ REA RV+ LDPNIR FI D+ H+AR++RM A + Sbjct: 121 AAVLFGCISLIAEPCGSVYETLMAREAPRRVMYLDPNIREIFIADRQKHLARMRRMIALA 180 Query: 181 DIVKFSDEDLDWFGLQGDHDALAAHWLNHGAKLVVITKGAEGASGYTKDRKVTVPSERVT 240 DIVK SDEDL WF G+ + WL G KL+V+T+GA+GA +T D + VP+ RV Sbjct: 181 DIVKLSDEDLAWFAEPGEEHEVIRRWLALGPKLIVVTRGADGADAWTADFHLHVPAIRVA 240 Query: 241 VVDTVGAGDTFDAGILASLKMDNLLTKRQVASLDEQALRNGPD 283 V DTVGAGDT +AGILASL LL K ++ +L + +R D Sbjct: 241 VADTVGAGDTVNAGILASLSQAGLLEKEKLVTLSREQVRRAVD 283 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 314 Length adjustment: 28 Effective length of query: 298 Effective length of database: 286 Effective search space: 85228 Effective search space used: 85228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory