Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate BWI76_RS14900 BWI76_RS14900 oxidoreductase
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__Koxy:BWI76_RS14900 Length = 331 Score = 130 bits (327), Expect = 4e-35 Identities = 86/241 (35%), Positives = 135/241 (56%), Gaps = 18/241 (7%) Query: 77 GYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGDFDLDGL 136 G ++++ AK GI+V+N P + ++A+ T+ ++LA +R + R+HD +R + + Sbjct: 101 GIENVNQAEAKARGIEVMNTPGRNARSVAEFTVGMILAEMRNIARSHDALRDKFWRKESP 160 Query: 137 MGF---DLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQP-EIVENVD-LDTLIT 191 +L GKV G++GLG I +LVA L+ FG +++ YD Y+ + E VD LD L+ Sbjct: 161 NHRAIPELGGKVVGLVGLGHIAQLVAGFLRGFGSEIIFYDKYVAGHDSYEKVDSLDELVR 220 Query: 192 QADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLGGAA 251 +AD+IS+H LT E ++ N F MK AI+VNTAR GLI+ L+ AL++GK+ GAA Sbjct: 221 RADVISLHARLTAETENLINAHHFDLMKESAIIVNTARSGLINEADLIAALRAGKIMGAA 280 Query: 252 LDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEETTVENIL 311 LD ++ E P + L NV +T H A T +A N + E +L Sbjct: 281 LDTFDDE-------------PLPDDSAFYSLNNVTITPHIAGSTIDAFSNSPKLFSEILL 327 Query: 312 E 312 + Sbjct: 328 K 328 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 331 Length adjustment: 28 Effective length of query: 297 Effective length of database: 303 Effective search space: 89991 Effective search space used: 89991 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory