Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate BWI76_RS26540 BWI76_RS26540 D-isomer specific 2-hydroxyacid dehydrogenase family protein
Query= BRENDA::O66939 (334 letters) >FitnessBrowser__Koxy:BWI76_RS26540 Length = 317 Score = 139 bits (349), Expect = 1e-37 Identities = 86/255 (33%), Positives = 132/255 (51%), Gaps = 17/255 (6%) Query: 53 KLTEELLSKMPRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAMILTL 112 K+++ + +LK++ G+D +DL+ K+ G++V + P + SVAE +L Sbjct: 53 KMSDRVFEAAKKLKVVARHGAGYDTVDLESAKRHGVVVLNAPIANSMSVAELAIFYMLHC 112 Query: 113 VKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSRVAMYGL-AFGMKVLCYD 171 + K +++++ + + EL+ TLG+IG G IGSRVA+ L F MKV+ YD Sbjct: 113 SRNFKLVQEKMLEDYYWAKLRTPKVELDGKTLGLIGVGNIGSRVAIKALHGFNMKVIAYD 172 Query: 172 VVKREDLKEKGCVYTS-LDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTA 230 K + +G T D + ESD +SLH P T ET + E++ S+MK Y INTA Sbjct: 173 PYKTQQQIPEGVELTDDFDRIFTESDFVSLHCPTTAETTDFVGEKQFSMMKPSAYFINTA 232 Query: 231 RGKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVI 290 RGK+VD ALY A +G G+DV + E D N I L+ N++ Sbjct: 233 RGKLVDEKALYHALSTHAIAGAGVDVLKKEPF------------DANDPIFSLS---NIV 277 Query: 291 ITPHIAYYTDKSLER 305 I PHI T ++ +R Sbjct: 278 IAPHIGAATIEATDR 292 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 317 Length adjustment: 28 Effective length of query: 306 Effective length of database: 289 Effective search space: 88434 Effective search space used: 88434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory