Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate BWI76_RS26960 BWI76_RS26960 bifunctional glyoxylate/hydroxypyruvate reductase B
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__Koxy:BWI76_RS26960 Length = 323 Score = 132 bits (333), Expect = 9e-36 Identities = 89/251 (35%), Positives = 129/251 (51%), Gaps = 18/251 (7%) Query: 70 RLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTRE 129 R + S GY++ D+ A A + ++H P VA+ + L+L+ RR+ NR + Sbjct: 68 RATSTISVGYDNFDVDALNARKVLLMHTPTVLTETVADTVMALVLSTARRVVEVANRVKA 127 Query: 130 GDFSLH---GLTGFDLHGKRVGVIGTGQIGETFA-RIMAGFGCELLAYDPYPNPRIQA-L 184 G+++ G D+H K +G++G G+IG A R AGFG +L +P+ + Sbjct: 128 GEWTKSIGPDWFGNDVHHKTLGIVGMGRIGMALAQRAHAGFGMPILYNARRQHPQAEERF 187 Query: 185 GGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAALI 244 RY LD LL E+D V L PLT +T HL + A MK A+ IN GRG +V+ ALI Sbjct: 188 NARYCDLDTLLQEADFVCLILPLTEETHHLFGKAQFAKMKSSAIFINAGRGPVVDEKALI 247 Query: 245 EALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREAL 304 AL+ G++ GLDV+E+E PL D + LLS PNVV H T E Sbjct: 248 AALQEGEIYAAGLDVFEQE-----------PLAKD--SPLLSMPNVVALPHIGSATHETR 294 Query: 305 AAIADTTLDNI 315 +A +DN+ Sbjct: 295 YNMAACAVDNL 305 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 323 Length adjustment: 28 Effective length of query: 301 Effective length of database: 295 Effective search space: 88795 Effective search space used: 88795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory