Align L-lactate dehydrogenase 1; L-LDH 1; EC 1.1.1.27 (characterized)
to candidate BWI76_RS15220 BWI76_RS15220 L-lactate dehydrogenase
Query= SwissProt::A6QDL6 (317 letters) >FitnessBrowser__Koxy:BWI76_RS15220 Length = 314 Score = 251 bits (640), Expect = 2e-71 Identities = 124/308 (40%), Positives = 190/308 (61%), Gaps = 1/308 (0%) Query: 5 KGNKVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMDLKHATPYSPTTVRV 64 K KV++IG G VG+S A++L+NQS+ +EL+++DL+ + DL A Y P + + Sbjct: 4 KARKVMIIGAGNVGASAAYALLNQSVCEELILVDLNKPRAEAHAQDLSDAAAYMPGMMTI 63 Query: 65 KAGEYSDCHDADLVVIC-AGAAQKPGETRLDLVSKNLKIFKSIVGEVMASKFDGIFLVAT 123 E SDC D D+ VI +G A KPG+TRLD ++ KI KS+V ++M F+GIFLVAT Sbjct: 64 STREASDCADVDIAVITVSGGALKPGQTRLDELTNTAKIVKSLVPQMMNGGFNGIFLVAT 123 Query: 124 NPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEAFDVAPRSVDAQIIGEHGDTE 183 NP DI+ + W+ SGLP+ +V+G+G LD+ R R +L++A D+ +S+DA I+GEHGD + Sbjct: 124 NPCDIITWQVWQLSGLPRGQVLGTGVWLDTTRLRRVLAQALDIGAQSIDAFILGEHGDAQ 183 Query: 184 LPVWSHANIAGQPLKTLLEQRPEGKAQIEQIFVQTRDAAYDIIQAKGATYYGVAMGLARI 243 PVWSH+ + G + + ++ + I + R ++I KG T YGVA +A I Sbjct: 184 FPVWSHSAVYGSAIADVYQKHTGKALDRDLIADKVRKLGFEIYAGKGCTEYGVAGTIAEI 243 Query: 244 TEAIFRNEDAVLTVSALLEGEYEEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSA 303 IF L VS +L+GEY GVPAV+ ++G++ ++E+ L D+E KF H+ Sbjct: 244 CRNIFTGSHRALAVSCILDGEYGVTGAAAGVPAVLTQSGVQQIIELQLADDEAEKFRHAI 303 Query: 304 KTLKDIMA 311 + +K +A Sbjct: 304 EVIKASIA 311 Lambda K H 0.317 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 314 Length adjustment: 27 Effective length of query: 290 Effective length of database: 287 Effective search space: 83230 Effective search space used: 83230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS15220 BWI76_RS15220 (L-lactate dehydrogenase)
to HMM TIGR01771 (L-lactate dehydrogenase (EC 1.1.1.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01771.hmm # target sequence database: /tmp/gapView.18401.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01771 [M=299] Accession: TIGR01771 Description: L-LDH-NAD: L-lactate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-109 350.7 0.0 3.9e-109 350.5 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS15220 BWI76_RS15220 L-lactate dehydrog Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS15220 BWI76_RS15220 L-lactate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 350.5 0.0 3.9e-109 3.9e-109 1 298 [. 10 307 .. 10 308 .. 0.98 Alignments for each domain: == domain 1 score: 350.5 bits; conditional E-value: 3.9e-109 TIGR01771 1 iiGagaVGssvafalltqgladelvliDinedkaegealdlsdaasflkskvkvkagdyedlkdadlvvit 71 iiGag+VG+s+a+all+q++++el+l+D+n+ +ae++a dlsdaa++++ +++++++++d++d+d+ vit lcl|FitnessBrowser__Koxy:BWI76_RS15220 10 IIGAGNVGASAAYALLNQSVCEELILVDLNKPRAEAHAQDLSDAAAYMPGMMTISTREASDCADVDIAVIT 80 8********************************************************************** PP TIGR01771 72 a.GaeqkpgetRlelveknvkilksivkevvksgfdgillvvsNPvDiltyvvlklsglpkerviGsGtvL 141 + G + kpg+tRl+++++++ki+ks+v+++++ gf+gi+lv++NP+Di+t v++lsglp+ +v+G+G++L lcl|FitnessBrowser__Koxy:BWI76_RS15220 81 VsGGALKPGQTRLDELTNTAKIVKSLVPQMMNGGFNGIFLVATNPCDIITWQVWQLSGLPRGQVLGTGVWL 151 845667***************************************************************** PP TIGR01771 142 dtaRlrrllaeklevdpksvhayvlGEHGdsevavwssakiagvplkelleekekekekelkeiekevrda 212 dt+Rlrr+la++l++ ++s++a++lGEHGd++++vws+ + g + ++ +++ + k + + i ++vr+ lcl|FitnessBrowser__Koxy:BWI76_RS15220 152 DTTRLRRVLAQALDIGAQSIDAFILGEHGDAQFPVWSHSAVYGSAIADVYQKH-TGKALDRDLIADKVRKL 221 *************************************************9855.558888889******** PP TIGR01771 213 ayeiiekKgaTsygiglavariveailkdekrvlpvsallegeygikdvylgvPavlgknGveeilelkLs 283 ++ei+ Kg+T+yg++ ++a+i+++i++ ++r l vs++l+geyg+++ + gvPavl+++Gv++i+el+L lcl|FitnessBrowser__Koxy:BWI76_RS15220 222 GFEIYAGKGCTEYGVAGTIAEICRNIFTGSHRALAVSCILDGEYGVTGAAAGVPAVLTQSGVQQIIELQLA 292 *********************************************************************** PP TIGR01771 284 eeEkeklkksaetlk 298 ++E ek+++++e++k lcl|FitnessBrowser__Koxy:BWI76_RS15220 293 DDEAEKFRHAIEVIK 307 ************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory