Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 227 bits (579), Expect = 2e-64 Identities = 131/308 (42%), Positives = 191/308 (62%), Gaps = 25/308 (8%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 +LQQ+VNG+++G YALIAIGYTMVYG++ +INFAH +V M+G AF + L + +GL Sbjct: 6 FLQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVG---AFTTLFLFSSIGLP 62 Query: 67 SVPLMMLAAFAASIIVTSA----FGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNA-- 120 F ++ +T A FG I+RVAYRPLR +++ LI+AIG+S FL+N Sbjct: 63 ---------FGVAVFLTLALCGLFGMLIDRVAYRPLRQASKISMLITAIGVSFFLENLFN 113 Query: 121 VMLSQDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLG 180 V+ S+ + P FG+ V+I+ + ++ ++T L++ + + R+R G Sbjct: 114 VLFGGSSRFFSAPDFFNNTRAFGD-----VIITNVAWIVPLITVLLLLAILWLLYRTRYG 168 Query: 181 RACRACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIK 240 A RA A D+ L+GI++N II+L F +G++LAA+ V + Y I+P +G L G+K Sbjct: 169 MAIRAVAFDVNTVRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLK 228 Query: 241 AFTAAVLGGIGSIPGAMLGGLLLGVAEAFGADVFGD--QYKDVVAFGLLILVLLFRPTGI 298 AF AAVLGGIGS+ GA+LGG +LG E +F + YKD AF LILVLLFRP GI Sbjct: 229 AFAAAVLGGIGSVTGAVLGGFILGFTEVVAVALFPELGGYKDAFAFMFLILVLLFRPVGI 288 Query: 299 LGRPEVEK 306 +G +E+ Sbjct: 289 MGDERLER 296 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 299 Length adjustment: 27 Effective length of query: 280 Effective length of database: 272 Effective search space: 76160 Effective search space used: 76160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory