Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate BWI76_RS07280 BWI76_RS07280 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >FitnessBrowser__Koxy:BWI76_RS07280 Length = 316 Score = 243 bits (619), Expect = 6e-69 Identities = 137/305 (44%), Positives = 187/305 (61%), Gaps = 12/305 (3%) Query: 8 LQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLDS 67 +QQ++NG+ +GS YALIA+GYTMVYGI+ +INFAHG++ M+G+ + L Sbjct: 5 IQQIINGVMLGSIYALIALGYTMVYGILRIINFAHGDILMVGALTTLSGMHALNAHFPTL 64 Query: 68 VPLMMLA-AFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 PL L A ++ V + ++ER AYR LR RL PLIS IG+S+ LQ M+ Sbjct: 65 PPLAQLGLALLLAMTVCALLAMAVERFAYRRLRNAPRLAPLISGIGVSVLLQTVAMIVWS 124 Query: 127 SKEKAIPTLLPGNFV---FGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRAC 183 P +LP + + G ++ +I+ I+ + VM GL L + +RLGR Sbjct: 125 RNPLMFPQILPMDPIAVTHGSAAHPPALITVTGIVTVALALTVMLGLWLLVEYTRLGRGM 184 Query: 184 RACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFT 243 RA AE+ ++ L+G+N N IIALTF IG AA+A V++ YG +GFL GIKAFT Sbjct: 185 RAVAENPRIATLMGVNPNAIIALTFAIGGVFAALAGVMMASNYGSAGFSMGFLPGIKAFT 244 Query: 244 AAVLGGIGSIPGAMLGGLLLGVAEAFGA--------DVFGDQYKDVVAFGLLILVLLFRP 295 AAVLGGIG+I GAM+GGLLLG+ E+ GA VFG Y+D+ AF +LILVL+FRP Sbjct: 245 AAVLGGIGNIRGAMIGGLLLGLIESLGAGYLGDLTHGVFGSNYQDIFAFMVLILVLVFRP 304 Query: 296 TGILG 300 G+LG Sbjct: 305 AGLLG 309 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 316 Length adjustment: 27 Effective length of query: 280 Effective length of database: 289 Effective search space: 80920 Effective search space used: 80920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory