Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate BWI76_RS07360 BWI76_RS07360 phenylalanine transporter
Query= TCDB::F2HQ25 (459 letters) >FitnessBrowser__Koxy:BWI76_RS07360 Length = 458 Score = 299 bits (766), Expect = 1e-85 Identities = 161/420 (38%), Positives = 246/420 (58%), Gaps = 17/420 (4%) Query: 12 RGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFFFLRTIGEMLYN 71 RGLQNRHIQLIA+ G IGTGLFLG G IQM GP+V+ Y + GI F +R +GEM+ Sbjct: 20 RGLQNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAVLLGYAVAGIVAFLIMRQLGEMVVE 79 Query: 72 DPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFWLPQVPLWLIEI 131 +P SF +F KY G G+ + W+YW++ V V ++ELTA G Y+Q+WLP VP W+ Sbjct: 80 EPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPTWIWAA 139 Query: 132 VMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHYSTVLSGKTVHD 191 ++ +N +N R +GE EFWFA+IKV AIIGMI + ++ G S Sbjct: 140 AFFLIINAVNLVNVRLYGEAEFWFALIKVLAIIGMIGFGLWMLFGGHGGS---------- 189 Query: 192 SASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPKKSLPKAINQIP 251 A + N++ F G + +L ++MF+F +E IG+TAAE NP+KS+PKA+NQ+ Sbjct: 190 KAGIDNLWKHGGFFATGWHGLIMSLAVIMFSFGGLELIGITAAEAQNPEKSIPKAVNQVV 249 Query: 252 VRILLFYVGALLAIMAIFNWHYIPADKSPFVMVFQLIGIKWAAALINFVVLTSAASALNS 311 RILLFY+G+L+ ++A++ W I +D SPFVM+F + A+ +NFV+L ++ S NS Sbjct: 250 YRILLFYIGSLVVLLALYPWVEIQSDSSPFVMIFHNLDSNVVASALNFVILVASLSVYNS 309 Query: 312 SLFSATRNMYSLAQQHDKGRLTPFTKLSKAGIPINALYMATALSLLAPVLT-LIPQIKNA 370 ++S +R ++ L+ Q + + ++SK G+P+N+L ++ ++ L VL L+PQ Sbjct: 310 GVYSNSRMLFGLSVQGNAPKF--LARVSKRGVPVNSLLLSGIITSLVVVLNYLLPQKALG 367 Query: 371 FDFA---ASCTTNLFLVVYFITLYTYWQYRKSEDYNPKGFLTPKPQ-ITVPFIVAIFAIV 426 A A+ N ++ + Q RK + K L+P I + F+ I ++ Sbjct: 368 LLMALVVATLLLNWIMICLAHLKFRAAQRRKGREPKFKALLSPASNYICIAFLALILVLM 427 Lambda K H 0.329 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 458 Length adjustment: 33 Effective length of query: 426 Effective length of database: 425 Effective search space: 181050 Effective search space used: 181050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory