Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate BWI76_RS11495 BWI76_RS11495 hypothetical protein
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Koxy:BWI76_RS11495 Length = 284 Score = 111 bits (277), Expect = 2e-29 Identities = 77/236 (32%), Positives = 124/236 (52%), Gaps = 15/236 (6%) Query: 36 SVKAAIKNGYRSIDTAAIYKN---EEGVGIGIKESGVAREELFITSKVWNEDQGYETTLA 92 +++A I G IDTA +Y + EE VG I+ R+ + + SKV+ + G Sbjct: 37 ALRAGIDLGLTVIDTAEMYADGGAEEVVGEAIRGQ---RDRVVLVSKVYPWNAGGRKIAR 93 Query: 93 AFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSNFQVHHLEELL 152 A E SL RL DYLDLYL+HW G ++T +E L GKIR GVSN +++L Sbjct: 94 ACEASLRRLNTDYLDLYLLHWRGDYSLQETVAGMEALVAQGKIRRWGVSNLDEDDMQQLW 153 Query: 153 K-DAEIKPMVNQVEFH--PRLTQKELRDYCKGQGIQLEAWSPLMQ-----GQLLDNEVLT 204 + + + NQV +H R + +L +C+ + + + A+ PL Q LL++ V+ Sbjct: 154 QVEGGERCATNQVLYHLASRGIEYDLLPWCQQRRLPVMAYCPLAQAGRLRNGLLNHTVVK 213 Query: 205 QIAEKHNKSVAQVILRWDLQH-GVVTIPKSIKEHRIIENADIFDFELSQEDMDKID 259 IA++ + AQ++L W + H V+ IPK+ + +NA D L+ E++ +D Sbjct: 214 NIAQERGVTAAQILLAWVISHREVLAIPKASSIEHVAQNAAALDIVLNDEELALLD 269 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 284 Length adjustment: 26 Effective length of query: 250 Effective length of database: 258 Effective search space: 64500 Effective search space used: 64500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory