Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate BWI76_RS24305 BWI76_RS24305 2,5-didehydrogluconate reductase A
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Koxy:BWI76_RS24305 Length = 275 Score = 253 bits (647), Expect = 2e-72 Identities = 117/269 (43%), Positives = 190/269 (70%), Gaps = 7/269 (2%) Query: 9 VKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESG 68 +KLH+G MP GLGV+K N E ++ A++ GYRS DTAA+Y+NE GVG + +G Sbjct: 7 IKLHDGNLMPQLGLGVWKAGN-EEVVSAIHKALEVGYRSFDTAAVYQNETGVGNALSSAG 65 Query: 69 VAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWP--GKDKYKDTWRAL 126 V R+ELF+T+K+WN+DQ + A ++SL++L+LDY+DLYLIHWP + + D W++L Sbjct: 66 VPRDELFVTTKLWNDDQ--KQPKEALQESLKKLKLDYVDLYLIHWPVPATNHFVDAWKSL 123 Query: 127 EKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQL 186 +L + G ++IGV NFQVHHL++++ + + P++NQ+E HP + Q++L + IQ Sbjct: 124 IELQQQGLAKSIGVCNFQVHHLQKIIDETGVAPVINQIELHPLMQQRQLHAWNATHKIQT 183 Query: 187 EAWSPLMQG--QLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENAD 244 E+WSPL QG + D +++ Q+A+K+ K+ AQ+++RW L G+V IPKS+ RI EN + Sbjct: 184 ESWSPLAQGGEGVFDQKIIRQLADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFN 243 Query: 245 IFDFELSQEDMDKIDALNKDERVGPNPDE 273 ++DF L ++++ +I L++++R+GP+PD+ Sbjct: 244 VWDFRLDKDELSEITKLDQNKRLGPDPDQ 272 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 275 Length adjustment: 25 Effective length of query: 251 Effective length of database: 250 Effective search space: 62750 Effective search space used: 62750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory