GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Klebsiella michiganensis M5al

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate BWI76_RS17800 BWI76_RS17800 long-chain-fatty-acid--CoA ligase

Query= SwissProt::P39062
         (572 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS17800 BWI76_RS17800
           long-chain-fatty-acid--CoA ligase
          Length = 572

 Score =  157 bits (398), Expect = 8e-43
 Identities = 137/521 (26%), Positives = 236/521 (45%), Gaps = 53/521 (10%)

Query: 72  EKYTFKEMKEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAIKIGAIAGPLFE 131
           E  T+++++E S      L+    ++KGDRV + MP   +    + G ++ G I   +  
Sbjct: 58  EVMTYRKLEERSRAFAAYLQEGLGLQKGDRVALMMPNLLQYPVALFGILRAGMIVVNVNP 117

Query: 132 AFMEGAVKDRLENSEAKVVVTTPEL---LERIPVDKLPHLQHVFV--VGGEAESGTN-II 185
            +    ++ +L +S A  +V        LE++ VDK   ++HV +  +G +       ++
Sbjct: 118 LYTPRELEHQLNDSGAAAIVIVSNFAHTLEKV-VDKT-QVKHVILTRMGDQLSPAKGTVV 175

Query: 186 NYD-------------------EAAKQESTRLDIEWMD--KKDGFLLHYTSGSTGTPKGV 224
           N+                     +A Q   R+     +   +D   L YT G+TG  KG 
Sbjct: 176 NFVVKYIKRLVPKYHLPDAISFRSALQHGYRMQYIKPEIVPQDLAFLQYTGGTTGVAKGA 235

Query: 225 LHVHEAMIQQYQ--TGKWVLDLKEEDIYWCTADPGWVTGTVYGIFAPWLNGATNVIVGGR 282
           +  H  M+   +   G +   L        TA P      +Y IFA  +N    + +GG+
Sbjct: 236 MLTHRNMLANLEQVNGTYGPLLHRGKELVVTALP------LYHIFALTMNCLLFIELGGQ 289

Query: 283 ----FSPESWYGTIEQLGVNVWYSAPTAFRMLMGA--GDEMAAKYDLTSLRHVLSVGEPL 336
                +P    G +++L     ++A T    L  A   ++   + D +SL      G P+
Sbjct: 290 NLLITNPRDIPGLVKELA-KYPFTAMTGVNTLFNALLNNKEFQQLDFSSLHLSAGGGMPV 348

Query: 337 NPEVIRWGHKVFNKRIHDTWWMTETGSQLICNYPCMDIKPGSMGKPIPGVEAAIVDNQGN 396
              V     K+  + + + + +TE    +  N   +D   GS+G P+P  EA +VD+  N
Sbjct: 349 QQVVAERWVKLTGQYLLEGYGLTECAPLVSVNPHDIDYHSGSIGLPVPSTEAKLVDDDDN 408

Query: 397 ELPPYRMGNLAIKKGWPSMMHTIWNNPEKYESYFMPGGWYVSGDSAYMDEEGYFWFQGRV 456
           E+PP   G L +K   P +M   W  P+   +  +  GW  +GD A MDEEG+     R 
Sbjct: 409 EVPPGEPGELCVKG--PQVMLGYWQRPDA-TAEIIKDGWLHTGDIAVMDEEGFLRIVDRK 465

Query: 457 DDVIMTSGERVGPFEVESKLVEHPAIAEAGVIGKPDPVRGEIIKAFIALREGFEPSDKLK 516
            D+I+ SG  V P E+E  +++H  + E   +G P    GE +K F+  ++       L 
Sbjct: 466 KDMILVSGFNVYPNEIEDVVMQHAGVQEVAAVGVPSGSSGEAVKIFVVKKD-----PTLT 520

Query: 517 EEIRL-FVKQGLAAHAAPREIEFKDKLPKTRSGKIMRRVLK 556
           EE+ + F ++ L  +  P+ +EF+D+LPK+  GKI+RR L+
Sbjct: 521 EEMLITFCRRQLTGYKVPKHVEFRDELPKSNVGKILRRELR 561


Lambda     K      H
   0.318    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 812
Number of extensions: 51
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 572
Length of database: 572
Length adjustment: 36
Effective length of query: 536
Effective length of database: 536
Effective search space:   287296
Effective search space used:   287296
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory