Align uridine phosphorylase; EC 2.4.2.3 (characterized)
to candidate BWI76_RS01010 BWI76_RS01010 uridine phosphorylase
Query= CharProtDB::CH_003939 (253 letters) >FitnessBrowser__Koxy:BWI76_RS01010 Length = 249 Score = 153 bits (387), Expect = 3e-42 Identities = 84/215 (39%), Positives = 127/215 (59%), Gaps = 16/215 (7%) Query: 8 HLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCST 67 H+ L+K ++ GA A++PGDP RV++IA +D P L +REF R G ++V ST Sbjct: 6 HIQLSK-EMTGARYALLPGDPQRVDRIANFLDNPQPLGQNREFRAARGWYQGVEILVLST 64 Query: 68 GIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLE 127 GIGGP T+IA+EEL Q+G+ T +RIG+ GA+Q ++ +GDV++ A+V DG S +AP Sbjct: 65 GIGGPFTAIAIEELRQIGVTTLIRIGSCGALQDNLALGDVIIAHAAVMDDGTSRTYAPAG 124 Query: 128 FPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQE-RYDTYSGRVVRHFKGSMEE 186 +PA AD + T L+ A+ + G+ S D+FY +E D + Sbjct: 125 YPACADPQLTWELMAQARQMNIPAACGLVRSHDSFYTDREAELDA--------------Q 170 Query: 187 WQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIV 221 W A G++ +MESA L+T+ A +GLR + V+V Sbjct: 171 WSARGILGADMESAALMTIGALRGLRTASLLNVVV 205 Lambda K H 0.318 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 249 Length adjustment: 24 Effective length of query: 229 Effective length of database: 225 Effective search space: 51525 Effective search space used: 51525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory