GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupC in Klebsiella michiganensis M5al

Align Nucleoside permease; Flags: Precursor (characterized, see rationale)
to candidate BWI76_RS04125 BWI76_RS04125 NupC/NupG family nucleoside CNT transporter

Query= uniprot:A0KU05
         (419 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS04125 BWI76_RS04125 NupC/NupG
           family nucleoside CNT transporter
          Length = 425

 Score =  555 bits (1430), Expect = e-163
 Identities = 289/431 (67%), Positives = 353/431 (81%), Gaps = 18/431 (4%)

Query: 1   MNILMSLVGVVVLLAIGFLLSNNKKAINLRTVGGALAIQAAFGGFVLYVPVGKDILKSVS 60
           M I+M L+G+VVLLAI  LLS+N+KAINLRTV GA  IQ   G  +LYVP G+  L ++S
Sbjct: 1   MQIIMGLIGMVVLLAIAVLLSSNRKAINLRTVLGAWIIQVGIGALILYVPAGRTALLAMS 60

Query: 61  DAVSSVIGYAQNGIGFLFGDLANFKL-------GFIFAVNVLPVIVFFSSLIAVLYYLGI 113
           + V++VI Y   GIGF+FG L + K+       GF+FA+ VLPVIVFFSSLIAVLYYLGI
Sbjct: 61  NGVANVIAYGNEGIGFIFGGLVSDKMFEVFGGGGFVFALRVLPVIVFFSSLIAVLYYLGI 120

Query: 114 MQWIIRIIGGGLQKALGTSRTESMSATANIFVGQTEAPLVVRPFIPTMTQSELFAIMVGG 173
           MQ++IRI+GG L+  L TSRTES+SATANIFVGQTEAPLVVRP+I TMT+SELFA+M GG
Sbjct: 121 MQFVIRILGGALRAVLKTSRTESLSATANIFVGQTEAPLVVRPYIATMTRSELFAVMCGG 180

Query: 174 LASIAGSVLAGYAQMGVPIEYLVAASFMAAPGGLLMAKLMHPETEVAKND--MDELPEDP 231
           LAS+AGSVLAGYAQMGVP+EYL+AASFMAAPGGLL AK++ PETE  +++  M++   DP
Sbjct: 181 LASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKIIVPETEQPRDNPAMEKNDADP 240

Query: 232 DKPANVLDAAAAGASSGMHLALNVGAMLLAFVGLIAMINGIIGGVGGWFGVEGLTLELIL 291
             PANVLDAAA+GA+SGM LALNVGAMLLAF+ LIA++NGI+ GVGGWF    L+L++IL
Sbjct: 241 QAPANVLDAAASGAASGMQLALNVGAMLLAFIALIALVNGILSGVGGWFNHPDLSLQMIL 300

Query: 292 GYIFMPLAFLIGVPWNEALVAGSFIGQKIVVNEFVAYLNFAPYLK---DIADGGMIVADT 348
           G++F PLA++IGVPWNEA VAGSFIGQK+++NEFVAY+NF  YLK   ++A  G+ V  T
Sbjct: 301 GWVFSPLAWVIGVPWNEATVAGSFIGQKLIINEFVAYMNFGEYLKADTEVAAAGLQVIST 360

Query: 349 GLAMTDRTKAIISFALCGFANLSSIAILLGGLGAMAPNRRHDLAKLGIRAVIAGSLANLM 408
                  TKAIISFALCGFANLSSIAIL+GGLG MAPNRR ++A+LG+RAV AG+L+NLM
Sbjct: 361 ------HTKAIISFALCGFANLSSIAILIGGLGGMAPNRRQEIAQLGMRAVAAGTLSNLM 414

Query: 409 SATIAGLFLAI 419
           SATIAG+FLA+
Sbjct: 415 SATIAGVFLAL 425


Lambda     K      H
   0.325    0.142    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 686
Number of extensions: 28
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 419
Length of database: 425
Length adjustment: 32
Effective length of query: 387
Effective length of database: 393
Effective search space:   152091
Effective search space used:   152091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory