Align 2-ketogluconokinase (EC 2.7.1.13) (characterized)
to candidate BWI76_RS27485 BWI76_RS27485 aminoimidazole riboside kinase
Query= metacyc::MONOMER-12748 (320 letters) >FitnessBrowser__Koxy:BWI76_RS27485 Length = 319 Score = 102 bits (253), Expect = 2e-26 Identities = 89/291 (30%), Positives = 130/291 (44%), Gaps = 11/291 (3%) Query: 36 GADSNVAIGLARLGFKVAWLSRVGNDSLGRFVLDTLRAEGLDCRFVRCDPIHPTGFQLKS 95 GA +NV + +ARLG ++ +G+D GRF+ + G+D +R D + + + Sbjct: 31 GASANVGVCVARLGGTCGFIGCLGDDDAGRFLRQVFQDNGVDVSSLRLDASLTSAVLIVN 90 Query: 96 REDGGDDPRVEYFRRGSAASHLAISDLDPALLRARHLHATGIPPALSDS-ARELSGHLMH 154 G + Y A ++++ DL P + + + I L+DS ARE Sbjct: 91 LTADG-ERSFTYLVHPGADTYVSPQDL-PTFRKYEWFYFSSI--GLTDSPAREACLEGAR 146 Query: 155 TQRSAGHSVSFDPNLRPALWPSEALMIREINRLAALAHWVLPGLAEGRLLTGRDDPADIA 214 R AG V FD NLR +W + A + I R AALA E L+G D Sbjct: 147 RMREAGGYVLFDVNLRSKMWRNTAEIPDLIARSAALASICKVSADELCQLSGASHWQDAR 206 Query: 215 AFYLDQGAEAVVIKLGAHGAYYRTQLDAGFVEGVPVAQVVDTVGAGDGFAVGLISALLES 274 + D G + +I LGA GA T + F+ P +VVDT GAGD F GL+ L Sbjct: 207 YYMRDLGCDTTIISLGAEGALLIT-AEGEFLFPAPRVEVVDTTGAGDAFVGGLLFTLSRE 265 Query: 275 RG-----ILEAVQRANWIGSRAVQSRGDMEGLPLRHELPEHTPSLKTASAL 320 + EA+ AN G+ AV ++G M LP +L S A A+ Sbjct: 266 NYWNHALLAEAISNANACGAMAVTAKGAMTALPYPDQLNTFLSSRSLAQAM 316 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 319 Length adjustment: 28 Effective length of query: 292 Effective length of database: 291 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory