Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate BWI76_RS11780 BWI76_RS11780 2-deoxyglucose-6-phosphatase
Query= SwissProt::O06995 (226 letters) >FitnessBrowser__Koxy:BWI76_RS11780 Length = 222 Score = 76.6 bits (187), Expect = 3e-19 Identities = 61/214 (28%), Positives = 102/214 (47%), Gaps = 11/214 (5%) Query: 3 AVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDR--DMNERLKGISREESLESILIFGGA 60 A IFD+DG++ D+ A + + + R +M + L G+ ++ ++ A Sbjct: 9 AAIFDMDGLLIDSEPLWDKAELEVMASLGVDISRRHEMPDIL-GLR----IDLVVDLWFA 63 Query: 61 ETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSS--RN 118 + + ++ E+ R L+ + P LLPG + + K + +KIGLAS+S R Sbjct: 64 QQPWKGPDRAEVTARIINRAIQLVEEARP--LLPGARQAVALCKAQGLKIGLASASPLRM 121 Query: 119 APKILRRLAIIDDFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGISAI 178 K+L + D F A+ L KP P ++L AA L VSP +C A+ED+ G+ A Sbjct: 122 LEKVLTMFELRDQFDALASAEMLPFSKPHPQVYLNCAASLGVSPMNCVALEDSVNGMIAS 181 Query: 179 KSAGMFAVGVGQGQPMLGADLVVRQTSDLTLELL 212 K+A M ++ V + + V+ TLE L Sbjct: 182 KAARMRSIVVPEAENSRDPRFVLADVKLATLESL 215 Lambda K H 0.319 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 226 Length of database: 222 Length adjustment: 22 Effective length of query: 204 Effective length of database: 200 Effective search space: 40800 Effective search space used: 40800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory