Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate BWI76_RS17835 BWI76_RS17835 sugar ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >FitnessBrowser__Koxy:BWI76_RS17835 Length = 279 Score = 127 bits (318), Expect = 3e-34 Identities = 85/275 (30%), Positives = 142/275 (51%), Gaps = 17/275 (6%) Query: 12 YALVAVIILVAVFPFYYAILTS-----LKSGTALFRIDYWPTDISLANYAGIFSHGTFVR 66 + + A++++V V PF+ + T+ +K G L WP S N+ + + Sbjct: 12 WCIYALLLIVFVGPFWGIVATAFSGAPVKPGELLA----WPNQFSFENFIFAWMDIGVWQ 67 Query: 67 NLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLAGLFEL 126 L NS+LV + + ++ AAYALAR +FRG L+ L ILS M P+ + L+ + Sbjct: 68 YLLNSILVVFFGTVLQVSVSALAAYALARKKFRGVALVSLVILSTMMLPEEVIAIPLYMI 127 Query: 127 IRFVGIFNTPLALIFSYMIFTLP-----FTVWVLTTFMRDLPIEIEEAAIVDGASPWVVI 181 I + F +L SY+ LP F+++VLT FM +P E+EEAA +DGA+ W + Sbjct: 128 INWRLPF-IDASLYNSYLGMILPVVGWAFSIFVLTEFMSAIPKELEEAARIDGANEWQIF 186 Query: 182 TRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPWG 241 V +PL+ PAL T FI W+++L L + ++ T+PV + L + I Sbjct: 187 FHVILPLVKPALGTVVTFGFIMIWDQYLLPLIVVNQDSLNTIPVILGTLR--TDESITPN 244 Query: 242 NIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG 276 +A +++ +P +++ L Q+ G+ +G VKG Sbjct: 245 IFIAITLLAMLPSIIVYLGLQKHFNRGIMSGAVKG 279 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 279 Length adjustment: 25 Effective length of query: 251 Effective length of database: 254 Effective search space: 63754 Effective search space used: 63754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory