Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate BWI76_RS26295 BWI76_RS26295 glycerol-3-phosphate transporter membrane protein
Query= TCDB::G4FGN6 (278 letters) >FitnessBrowser__Koxy:BWI76_RS26295 Length = 281 Score = 118 bits (296), Expect = 1e-31 Identities = 80/269 (29%), Positives = 132/269 (49%), Gaps = 14/269 (5%) Query: 9 ILLYIAVVLILIWCVFPLYWAFISSIKPDRDLFEKNPSLFPKRITFENYVKVF------K 62 ++L IAV+L FPLY AF+++ + +F+ +L P EN ++ Sbjct: 16 LILGIAVIL------FPLYVAFVAATLDSKAVFDTPMTLIPGGHLLENMKFIWVNGVGAN 69 Query: 63 ERPFHINIKNSIIVAGITTVLALVVGSLAGYAIARLKFRGKVIVMSLILAVSMFPQVSIL 122 PF + + NS I+A TV + V L+ +AI +F + + +I M P + Sbjct: 70 SAPFWLMMLNSFIMAFGITVGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRI 129 Query: 123 GSLFLILRGLKLINTYTGLIIPYTAMNLPLTVWVLQSFFRELPKEVEESAFIDGASKLRT 182 ++ LK++++Y GL +P A ++ + FF LP E+ E+A IDGAS +R Sbjct: 130 FPTVEVIANLKMLDSYAGLTLPLMAS--ATATFLFRQFFMTLPDELIEAARIDGASPMRF 187 Query: 183 LWSIVLPMSAPGLVATGLLTFIAAWNEFLFALTFMQKPSLYTVPVAVALFKGASQYEIPW 242 IVL +S L A ++TFI WN++L+ L + +L T + Q W Sbjct: 188 FRDIVLQLSKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIAIGQGTTQW 247 Query: 243 GQLMAAAVIVTLPLVILVLVFQNRIIAGL 271 Q+MAA ++ +P V++VL Q + GL Sbjct: 248 NQVMAAMLLTLIPPVVIVLAMQRAFVRGL 276 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 281 Length adjustment: 26 Effective length of query: 252 Effective length of database: 255 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory