Align Alpha,alpha-phosphotrehalase (EC 3.2.1.93) (characterized)
to candidate BWI76_RS16585 BWI76_RS16585 trehalose synthase
Query= reanno::pseudo3_N2E3:AO353_15985 (549 letters) >FitnessBrowser__Koxy:BWI76_RS16585 Length = 541 Score = 177 bits (450), Expect = 7e-49 Identities = 149/560 (26%), Positives = 242/560 (43%), Gaps = 93/560 (16%) Query: 1 MQDWQ-RSVIYQIYPKSFHSHAGNPTGDLLGVVAKLDYLQWLGVDCLWITPFLRSPQRDN 59 M DW R++IYQI F+ + GD+ G+ AKL Y++ +G +WITPF +P D Sbjct: 1 MADWHTRAIIYQIDSALFYDFNSDGCGDIAGITAKLRYIRRMGATVIWITPFYLTPFLDE 60 Query: 60 GYDISDYYAIDPSYGTMADCELLIAEAGKRGIKLMLDIVVNHTSIEHSWFQQARSSLDNP 119 GYD+SD+ +DP +G +AD I +A + G+++++++++ HTS H WFQ+AR S +P Sbjct: 61 GYDVSDHLQVDPRFGQLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQRARRSRSSP 120 Query: 120 YRDFYIWRD-QPNNWESKFGG---SAWEYEAQTGQYFLHLFDHTQADLNWDNPQVRAEVF 175 +RD+Y+W D ++ F G S W ++ + GQYF H+F + DLN +P V EV Sbjct: 121 FRDYYLWADSDDDDTPPMFPGVEESIWTWDEEAGQYFRHMFYRHEPDLNLASPAVIKEVE 180 Query: 176 KLMRFWRDKGVGGFRLDVINLISKPADFPEDHTDGRRFYTDGPNVHEYLQEMHREVFEGH 235 ++ FW GV GFRLD ++K A GR G + E+L R + E H Sbjct: 181 NIIIFWLKLGVSGFRLDAAAHLTKQA--------GRGEEKRGLWILEHL----RRLVERH 228 Query: 236 D--LINVGEMSSTSLEHCIRYSRPDSKELSMTFNFHHLKVDYPNM--------------- 278 + I +GE+ ++ R D+ L+M NF K Y ++ Sbjct: 229 NPQAILLGEVDVDVEQY--RDYFGDNNRLNMVLNFWLNKYFYVSLASQNARPLINAIKKT 286 Query: 279 ---------QKWVRADFDFLELKRI-LSDWQTGMQAGGGWNALFWCNHDQPRVVSRFGDD 328 W+R + D L+L+ I + QT ++A + R ++ + Sbjct: 287 IVPPDACCFANWLR-NHDELDLEGIGNKNKQTVLEAFAPDEKMNVYQRGIRRRLAPMLNG 345 Query: 329 GEHRVVSAKMLGTALHFLQGTPFIYQGEELGMTNPGFERIEQYRDVETLNIYRLKREAGE 388 R+ L L G P + G+E+GM + Sbjct: 346 NRQRLA---FCHAVLFSLPGVPIMRYGDEIGMGDD------------------------- 377 Query: 389 SEASSMAAIMQKSRDNSRTPMQWSALPNAGFSSSEPWIGV-------PANAMQINVENQL 441 + + R RTPMQW+ GFS+++P V P ++NV + L Sbjct: 378 --------LALEERYAVRTPMQWAGSAGGGFSAADPDTFVAPMIDRGPFRYQKVNVADSL 429 Query: 442 DDTTSVLHHYRQLIALRRSEPLIQDGVYRQLLPTHKQVWVYLREGEGERLLVVNNFYGTA 501 S+LH + R P I +R + + + + ++ NF A Sbjct: 430 LHRHSLLHRIMDIANTRSEFPEIAVAPFRIISTDRQAILAICYDNHERSVITFLNFSEKA 489 Query: 502 CEVE---LPERVITDCMLQR 518 + E V T C+ + Sbjct: 490 LRFTAKGIDEAVWTPCLADK 509 Lambda K H 0.321 0.137 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 808 Number of extensions: 48 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 549 Length of database: 541 Length adjustment: 35 Effective length of query: 514 Effective length of database: 506 Effective search space: 260084 Effective search space used: 260084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory