GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TAT in Klebsiella michiganensis M5al

Align tryptophan permease (characterized)
to candidate BWI76_RS06025 BWI76_RS06025 amino acid transporter

Query= CharProtDB::CH_091156
         (592 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS06025 BWI76_RS06025 amino acid
           transporter
          Length = 468

 Score =  231 bits (590), Expect = 4e-65
 Identities = 150/427 (35%), Positives = 220/427 (51%), Gaps = 24/427 (5%)

Query: 78  LKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEI 137
           LKRT+K RHLIM+++GG IGTGLF  +G  I+  G  G ++ + I    +   +  LGE+
Sbjct: 11  LKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVVWLVMQCLGEL 70

Query: 138 TVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVI 197
           +V  P  GAF  Y  R+L P+  + V+ +Y L W   L     AA   +QYW   +   +
Sbjct: 71  SVAMPETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQYWFPQVPVWV 130

Query: 198 WVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICG--------GGPD 249
           W  +F AVI ++N+   R F E EF FS +K IT+  FIIL    I G          P 
Sbjct: 131 WCVVFCAVIFALNVISTRFFAEGEFWFSLVKVITIIAFIILGGAAIFGIIPMQDGSPAPG 190

Query: 250 HEFIGAKYWHDPGCLANGFPGVLSVLVVASYSLGGIEMTCLASGETD--PKGLPSAIKQV 307
              I A+ W   G    G P +L  +V  +++  G E+  +A+GET+   K +P AI+  
Sbjct: 191 LRNITAEGWFPHG----GLP-ILMTMVAVNFAFSGTELIGIAAGETENPHKVIPVAIRTT 245

Query: 308 FWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNSPFVIAIKLHHIKALPSIVNAVILIS 367
             R++ FF+ ++ ++  L+P      +  + V+ SPFV+  +   I     I N VIL +
Sbjct: 246 IARLIIFFIGTVFVLAALIP------MQQAGVEKSPFVLVFEKVGIPYAADIFNFVILTA 299

Query: 368 VLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSM 427
           +LS  NS ++AS R L S++++  +P  F  + R G PL  I  + L G+LA      + 
Sbjct: 300 ILSAANSGLYASGRMLWSLSNENTLPACFTKLTRNGVPLTAISVSMLGGVLALFSSVVAP 359

Query: 428 SEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALI 487
             VF  L AI+G A   VWLSI  SH  FR     QGK+L EL + +    W     AL 
Sbjct: 360 DTVFVALSAISGFAVVAVWLSICASHFMFRRRHLQQGKALSELHYRAP---WYPLVPALG 416

Query: 488 NCLILIA 494
             L L+A
Sbjct: 417 FVLCLVA 423


Lambda     K      H
   0.326    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 762
Number of extensions: 42
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 592
Length of database: 468
Length adjustment: 35
Effective length of query: 557
Effective length of database: 433
Effective search space:   241181
Effective search space used:   241181
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory