Align Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (characterized)
to candidate BWI76_RS13710 BWI76_RS13710 benzoate 1,2-dioxygenase small subunit
Query= reanno::pseudo3_N2E3:AO353_05955 (163 letters) >FitnessBrowser__Koxy:BWI76_RS13710 Length = 161 Score = 133 bits (334), Expect = 2e-36 Identities = 67/157 (42%), Positives = 95/157 (60%), Gaps = 2/157 (1%) Query: 8 QIEQFFYRKSELCDAKDWDAYIQLFDEQSEFHLPQWDSEHVYTRDPKREMSLIYYANRSG 67 Q+ QF Y ++ L D + WD ++ + Q + +P W + TRDP+RE+SLIYY NR G Sbjct: 6 QVRQFLYYEARLLDDRQWDEWLNCYSPQVVYWMPAWGDDDQLTRDPQREISLIYYPNRDG 65 Query: 68 LEDRVFRLHTGKAASATPMPRTLHLINNV-RISELEAGELEVRLNWHTLFYRLATSEQFY 126 LEDRV+R+ T ++ ++TP PRT H+I NV R+ E E G +EVR NW T +R ++ ++ Sbjct: 66 LEDRVYRIKTERSGASTPEPRTTHMIGNVERLGETEQG-MEVRYNWVTYCHRYQQTDTWF 124 Query: 127 GDATYRLKPHADSWLITRKHVLLLNDTINSVLDFYHL 163 G L A I RK V L ND I V+D YH+ Sbjct: 125 GSTCCTLIESAGKPQIIRKTVRLNNDYIRQVIDVYHI 161 Lambda K H 0.322 0.136 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 161 Length adjustment: 18 Effective length of query: 145 Effective length of database: 143 Effective search space: 20735 Effective search space used: 20735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory