Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate BWI76_RS23015 BWI76_RS23015 cobalt transporter ATP-binding subunit
Query= uniprot:P40735 (281 letters) >FitnessBrowser__Koxy:BWI76_RS23015 Length = 271 Score = 145 bits (366), Expect = 9e-40 Identities = 89/265 (33%), Positives = 148/265 (55%), Gaps = 7/265 (2%) Query: 6 LISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGD 65 +++ D+ FRY+ + L G++L +VG NG GKSTL L+GL+ P+SG Sbjct: 1 MLATTDLWFRYQDEP---VLKGLTLDFSHHAVTGLVGANGCGKSTLFMNLSGLLRPQSGA 57 Query: 66 IEVAG--IQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERV 123 ++ G + ++ + +R+++ VFQ+PD Q T + D+AF L N GV EE+ RV Sbjct: 58 VQWQGKPLDYSKRGLLALRQQVATVFQDPDQQIFYTDIDSDIAFSLRNLGVAEEEIARRV 117 Query: 124 DWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLE 183 D A+ V+ Q F Q LS GQK+RVAIAG + + ++LDE T+ LDP GR ++++ Sbjct: 118 DDALTLVDAQGFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDPSGRAQMID 177 Query: 184 TVRHLKEQGMATVISITHDLNEAAK-ADRIIVMNGGKKYAEGPPEEIFKLNKELVRIGLD 242 ++ + ++G IS +HD++ + +D + V+ G+ A G P E+F ++ + + GL Sbjct: 178 IIKRIADRGNHVAIS-SHDIDLIYEVSDAVYVLRRGEVLAHGEPGEVFARSELMAQAGLT 236 Query: 243 LPFSFQLSQLLRENGLALEENHLTQ 267 P+ +L L EE T+ Sbjct: 237 QPWLVKLHAQLGLPLCKTEEEFFTR 261 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 271 Length adjustment: 25 Effective length of query: 256 Effective length of database: 246 Effective search space: 62976 Effective search space used: 62976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory