GapMind for catabolism of small carbon sources

 

Aligments for a candidate for Bap2 in Klebsiella michiganensis M5al

Align valine/tyrosine/tryptophan amino-acid permease (characterized)
to candidate BWI76_RS06025 BWI76_RS06025 amino acid transporter

Query= CharProtDB::CH_091631
         (619 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS06025 BWI76_RS06025 amino acid
           transporter
          Length = 468

 Score =  223 bits (568), Expect = 1e-62
 Identities = 133/436 (30%), Positives = 225/436 (51%), Gaps = 30/436 (6%)

Query: 85  QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144
           Q+   L +++K+RHL+M+SLG  IGTGL    G ++ T G AG +L Y I +++++ ++Q
Sbjct: 6   QQGGQLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVVWLVMQ 65

Query: 145 AAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYW-T 203
             GEL +     TG +  Y +  + P+ G+ V+ +Y + W   L      A   ++YW  
Sbjct: 66  CLGELSVAMPE-TGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQYWFP 124

Query: 204 SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILA-------IIINC 256
            V   ++  V    +  +N+  +R +AE EF F+  K++ +I F+IL        I +  
Sbjct: 125 QVPVWVWCVVFCAVIFALNVISTRFFAEGEFWFSLVKVITIIAFIILGGAAIFGIIPMQD 184

Query: 257 GG-AGDRRYIGAEYWHNPGPFAHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIP 315
           G  A   R I AE W     F HG   +        F++ G E++ ++A E ENP K IP
Sbjct: 185 GSPAPGLRNITAEGW-----FPHGGLPILMTMVAVNFAFSGTELIGIAAGETENPHKVIP 239

Query: 316 NACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPH 375
            A +  + R+++ ++ T  ++  L+P            +G   SPFV+     G+     
Sbjct: 240 VAIRTTIARLIIFFIGTVFVLAALIPMQQ---------AGVEKSPFVLVFEKVGIPYAAD 290

Query: 376 FINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCI 435
             N VIL +++S ANS LY+  R+L SL+ +  LP C   + RNG PL    VS++ G +
Sbjct: 291 IFNFVILTAILSAANSGLYASGRMLWSLSNENTLPACFTKLTRNGVPLTAISVSMLGGVL 350

Query: 436 GFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGY 495
              ++  A + VF  L AIS  + + +W+S+  SH  FR    +QG++++E+ Y+A    
Sbjct: 351 ALFSSVVAPDTVFVALSAISGFAVVAVWLSICASHFMFRRRHLQQGKALSELHYRA---- 406

Query: 496 WGSWLAVLIAIFFLVC 511
              W  ++ A+ F++C
Sbjct: 407 --PWYPLVPALGFVLC 420


Lambda     K      H
   0.324    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 677
Number of extensions: 40
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 619
Length of database: 468
Length adjustment: 35
Effective length of query: 584
Effective length of database: 433
Effective search space:   252872
Effective search space used:   252872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory