GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acnD in Klebsiella michiganensis M5al

Align 2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) (EC 4.2.1.117) (characterized)
to candidate BWI76_RS11940 BWI76_RS11940 aconitate hydratase 1

Query= BRENDA::Q8EJW3
         (867 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS11940 BWI76_RS11940 aconitate
           hydratase 1
          Length = 890

 Score =  720 bits (1859), Expect = 0.0
 Identities = 395/864 (45%), Positives = 545/864 (63%), Gaps = 40/864 (4%)

Query: 33  GAYAKLPYTSRVLAENLVRRCEPEMLTASLKQII-----ESKQELDFPWFPARVVCHDIL 87
           G  ++LP + +VL ENL+R  + + +TA     +      +  + +  + PARV+  D  
Sbjct: 33  GDLSRLPKSLKVLLENLLRWQDGDSVTAEDIHALAGWLKHAHADREIAYRPARVLMQDFT 92

Query: 88  GQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQLIVDHSLAVEYGGFDKDAFAKNRAIEDR 147
           G  A+VDLA +R+A+   GGD A+VNP+ P  L++DHS+ V+  G D DAF +N  +E  
Sbjct: 93  GVPAVVDLAAMREAVKRLGGDTAKVNPLSPVDLVIDHSVTVDRFG-DDDAFEENVRLEME 151

Query: 148 RNEDRFHFINWTQKAFKNIDVIPQGNGIMHQINLERMSPVIHA--RNG--VAFPDTLVGT 203
           RN +R+ F+ W Q+AF    V+P G GI HQ+NLE +   + +  +NG  VAFPDTLVGT
Sbjct: 152 RNHERYVFLRWGQQAFSRFSVVPPGTGICHQVNLEYLGRAVWSEQQNGEWVAFPDTLVGT 211

Query: 204 DSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRLPDIIGVELTGKPQPGITATDIVLAL 263
           DSHT  ++ LGV+  GVGG+EAE+ MLG+   M +PD++G +L+GK + GITATD+VL +
Sbjct: 212 DSHTTMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPDVVGFKLSGKLREGITATDLVLTV 271

Query: 264 TEFLRAQKVVSSYLEFFGEGAEALTLGDRATISNMTPEFGATAAMFYIDQQTLDYLTLTG 323
           T+ LR   VV  ++EF+G+G ++L L DRATI+NM+PE+GAT   F ID  TLDY+ LTG
Sbjct: 272 TQMLRKHGVVGKFVEFYGDGLDSLPLADRATIANMSPEYGATCGFFPIDAVTLDYMRLTG 331

Query: 324 REAEQVKLVETYAKTAGLWSDDLKQAVYPRTLHFDLSSVVRTIAGPSNPHARVP------ 377
           R  EQV LVE YAK  G+W     + V+  TL  D+ +V  ++AGP  P  RV       
Sbjct: 332 RSEEQVALVEAYAKAQGMWRQPGDEPVFTSTLALDMGTVEASLAGPKRPQDRVALGDVPQ 391

Query: 378 ----TSELAA-------RGISGEVENEPGLMPDGAVIIAAITSCTNTSNPRNVIAAGLLA 426
               +SEL         R I   +  +   +PDGAV+IAAITSCTNTSNP  ++AAGLLA
Sbjct: 392 AFAASSELEVNHAQKDKRPIDYTLNGQQYSLPDGAVVIAAITSCTNTSNPSVLMAAGLLA 451

Query: 427 RNANAKGLTRKPWVKTSLAPGSKAVQLYLEEANLLPELESLGFGIVGFACTTCNGMSGAL 486
           + A  +GL  +PWVK SLAPGSK V  YL  A L P L+ LGF +VG+ CTTC G SG L
Sbjct: 452 KKAVERGLKPQPWVKASLAPGSKVVSDYLAHAKLTPWLDELGFNLVGYGCTTCIGNSGPL 511

Query: 487 DPVIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIEKD 546
              I++ +   DL   AVLSGNRNF+GRIHP  K  +LASPPLVVAYA+AG +  D+ ++
Sbjct: 512 PDPIERAIKQGDLTVGAVLSGNRNFEGRIHPLVKTNWLASPPLVVAYALAGNMNLDLTRE 571

Query: 547 VLGLDKDGKPVRLINIWPSDAEIDAVIAASVKPEQFRKVYEPMFDLSVDY-GDKV--SPL 603
            LG  KDG+PV L +IWPS  E+ A     V  E FRK Y  +F+ + ++   KV  S  
Sbjct: 572 PLGTGKDGQPVYLKDIWPSGIEV-AQAVEQVSTEMFRKEYAEVFEGTAEWKAIKVDRSDT 630

Query: 604 YDWRPQSTYIRRPPYWEGALAGERTLK---GMRPLAVLGDNITTDHLSPSNAIMMDSAAG 660
           YDW+  STYIR  P+++      + ++   G R LA+LGD++TTDH+SP+ +I  DS AG
Sbjct: 631 YDWQNDSTYIRLSPFFDEMGVEPKPVEDIHGARILAMLGDSVTTDHISPAGSIKADSPAG 690

Query: 661 EYLHKMGLPEEDFNSYATHRGDHLTAQRATFANPKLKNEMAIVDGKVKQGSLARIEPEGI 720
            YL   G+   DFNSY + RG+H    R TFAN +++NEM  V G   +G + R  P+  
Sbjct: 691 RYLQNHGVERIDFNSYGSRRGNHEVMMRGTFANIRIRNEM--VPG--VEGGMTRHLPDTQ 746

Query: 721 VTRMWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNL 780
              +++A   Y +   PL +IAG +YG GSSRDWAAKG RL GV  ++AE FERIHR+NL
Sbjct: 747 PIAIYDAAMLYKEEGTPLAVIAGKEYGSGSSRDWAAKGPRLLGVRVVIAESFERIHRSNL 806

Query: 781 VGMGVLPLEFKAGENRATYGIDGTEVFDV--IGSIAPRADLTVIITRKNGERVEVPVTCR 838
           +GMG+LPLEF  G  R T G++G E  D+  + ++ P   + V +TR +G +  +   CR
Sbjct: 807 IGMGILPLEFPQGMTRKTLGLNGEERIDISNLQALQPGMTVPVTLTRADGRQEVIDCRCR 866

Query: 839 LDTAEEVSIYEAGGVLQRFAQDFL 862
           +DTA E++ Y+  G+L    ++ L
Sbjct: 867 IDTATELTYYQNDGILHYVIRNML 890


Lambda     K      H
   0.318    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1952
Number of extensions: 102
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 867
Length of database: 890
Length adjustment: 43
Effective length of query: 824
Effective length of database: 847
Effective search space:   697928
Effective search space used:   697928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory