Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate BWI76_RS20065 BWI76_RS20065 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= reanno::Cup4G11:RR42_RS28545 (384 letters) >FitnessBrowser__Koxy:BWI76_RS20065 Length = 285 Score = 66.2 bits (160), Expect = 1e-15 Identities = 63/223 (28%), Positives = 98/223 (43%), Gaps = 13/223 (5%) Query: 22 EVRFDE-INGIGLITLNRPRQLNALSYPMIGLLDAQLAAWAARDDIAAVVLRGAGPKAFC 80 ++R+ + +GI IT+NRP+ NA + + LA D+I +VL G G KAFC Sbjct: 24 DIRYQKSADGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIVLTGEGDKAFC 83 Query: 81 AGGD--IRALYDSFHAGTALHRQFFVDEYQLDYRLHCYPKPVVALMDGIVMGGGMGLAQA 138 AGGD +R Y + + +H +D ++ PKPV+A++ G +GGG L Sbjct: 84 AGGDQKVRGDYGGYQDDSGVHHLNVLD---FQRQIRTCPKPVLAMVAGYSIGGGHVLHMM 140 Query: 139 AHLRVLTERSRVAMPETGIGLVP-DVGASHFLSKLPLALALYVGLTGVTLGAADTLLCKL 197 L + E + +G GAS+ + A + A L L Sbjct: 141 CDLTIAAENAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGL 200 Query: 198 ADIAVPAASLEHFEQTL----AAINRTGDVLADLRAALQATPD 236 + VP A LE ++T+ + + L L+AAL A D Sbjct: 201 VNTVVPLADLE--KETVRWCREMLQNSPMALRCLKAALNADCD 241 Lambda K H 0.322 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 285 Length adjustment: 28 Effective length of query: 356 Effective length of database: 257 Effective search space: 91492 Effective search space used: 91492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory