Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate BWI76_RS14155 BWI76_RS14155 transketolase
Query= metacyc::MONOMER-11684 (327 letters) >FitnessBrowser__Koxy:BWI76_RS14155 Length = 339 Score = 278 bits (712), Expect = 1e-79 Identities = 146/340 (42%), Positives = 211/340 (62%), Gaps = 16/340 (4%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGED--------------VGRKGGVFKATAGLYE 46 M + +Y +A+ A+ +EME D RV ++GED + GGV T GL+ Sbjct: 1 MPIKTYREAVKEALAQEMEHDERVVLIGEDLRGGHGGNAPEEARIEAFGGVLGVTKGLWT 60 Query: 47 QFGEERVMDTPLAESAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSN 106 QFG +RV+DTP+ ESAI G+ GAA G+RP+AE+ F DF + + + ++AAK RY Sbjct: 61 QFGSDRVIDTPITESAIVGMAAGAAATGLRPVAELMFMDFFGVSHDALYNQAAKFRYMFG 120 Query: 107 NDWSCPIVVRAPYGGGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDED 166 P+V+R G G A HSQS IFA PGLK+V+PSTPYD KGLL ++RD+D Sbjct: 121 GKAKAPLVMRGMIGAGFSAAAQHSQSPYNIFATTPGLKVVVPSTPYDVKGLLIQSIRDDD 180 Query: 167 PVLFFEHKRAYRLIKGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEK 226 PV+F EHK Y L KGEVP + Y +P+G A+ REG+D+T+I VH A Q A++L + Sbjct: 181 PVVFCEHKMLYDL-KGEVPDEIYTIPLGVANYTREGEDVTIIALSAMVHKANQVADKLAR 239 Query: 227 DGISAHVVDLRTVYPLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLD 286 +GIS VVD RT+ PLD+E I+E+ + TG+V++V E +VAA+I+ L Sbjct: 240 EGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARFGFAHDVAALIASQAFHFLK 299 Query: 287 APIKRLAGPDIPAMPYAPTMEKYFMVNPDKVEAAMRELAE 326 API + P P +P++P +EK ++ +++EAA+R++ E Sbjct: 300 APIVLVTPPHTP-VPFSPALEKLWIPGVERIEAAVRQVLE 338 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 339 Length adjustment: 28 Effective length of query: 299 Effective length of database: 311 Effective search space: 92989 Effective search space used: 92989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory