Align malonate-semialdehyde dehydrogenase (acetylating) (EC 1.2.1.18) (characterized)
to candidate BWI76_RS03070 BWI76_RS03070 methylmalonate-semialdehyde dehydrogenase (CoA acylating)
Query= reanno::pseudo5_N2C3_1:AO356_23175 (500 letters) >lcl|FitnessBrowser__Koxy:BWI76_RS03070 BWI76_RS03070 methylmalonate-semialdehyde dehydrogenase (CoA acylating) Length = 501 Score = 558 bits (1439), Expect = e-163 Identities = 274/497 (55%), Positives = 363/497 (73%), Gaps = 4/497 (0%) Query: 6 VVGHYIDGRIQASDNARLSNVFNPATGAVQARVALAEPSTVDAAVASALAAFPAWSEQSS 65 + G++I G+ S + + VF+PATG V V L+ V A+ A AF +WS + Sbjct: 3 ITGNFIGGKTVTSGSNKTMPVFDPATGKVVREVTLSTAQEVSDAIQVARDAFESWSRTTP 62 Query: 66 LRRSRVMFKFKELLDRHHDELAQIISREHGKVLSDAHGEVTRGIEIVEYACGAPNLLKTD 125 LRR+RVMF FK LL++H +ELA II EHGKV SDA GE+TRG+E+VE+ACG P+L+K + Sbjct: 63 LRRARVMFNFKMLLEQHAEELAGIIVSEHGKVFSDAMGELTRGMEVVEFACGIPHLIKGE 122 Query: 126 FSDNIGGGIDNWNLRQPLGVCAGVTPFNFPVMVPLWMIPLALVAGNCFILKPSERDPSAS 185 FS ++G G+D+++L QPLGV AG+TPFNFP MVP+WM PLAL GN F+LKP P+A+ Sbjct: 123 FSSDVGTGVDSYSLMQPLGVVAGITPFNFPAMVPMWMFPLALACGNSFVLKPPALAPTAA 182 Query: 186 LLMARLLTEAGLPDGVFNVVQGDKVAVDALLQHPDIEAISFVGSTPIAEYIHQQGTAQGK 245 + +A LL EAGLPDGVFNVV + L + P I A+SFVGS+ +AE+I++ +A GK Sbjct: 183 VRLAELLKEAGLPDGVFNVVHCSNEDAEQLYRDPRIAAVSFVGSSGVAEHIYKTASAYGK 242 Query: 246 RVQALGGAKNHMIVMPDADLDQAADALIGAAYGSAGERCMAISIAVAVGD-VGDELIAKL 304 RVQA G AKNH IVMPDADLD +A++G A+GSAGERCMA+ + VAVGD D+LIA+L Sbjct: 243 RVQAFGAAKNHAIVMPDADLDATVNAIMGGAFGSAGERCMALPVVVAVGDETADKLIARL 302 Query: 305 LPRIDQLKIGNGQQPG---TDMGPLVTAEHKAKVEGFIDAGVAEGARLIVDGRGFKVPGA 361 P ++ LK+G G G +MGP+V+ H+ KV G+ID GV+EGA L+VDGR +VPG Sbjct: 303 KPLVESLKVGPGCMRGKEENEMGPVVSDTHQKKVLGYIDKGVSEGATLVVDGRKPQVPGF 362 Query: 362 EQGFFVGATLFDQVTAEMSIYQQEIFGPVLGIVRVPDFATAVALINAHEFGNGVSCFTRD 421 E+G++VG TLFD VT EM+I+++EIFGPVLGIVRV D+ +A+ L+N+HEFGNG + FT + Sbjct: 363 EEGYYVGGTLFDNVTPEMTIWREEIFGPVLGIVRVADYHSALELVNSHEFGNGSAVFTSN 422 Query: 422 GGIARAFARSIKVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGLRFYSRYKSVM 481 G AR F ++ GMVG+NVP+PVPMA+HSFGGWKRS+FG + +G +G+RFY+R K+ Sbjct: 423 GHTAREFVHDVQAGMVGVNVPVPVPMAFHSFGGWKRSVFGALNVHGPDGVRFYTRMKTAT 482 Query: 482 QRWPDSIAKGPEFSMPT 498 RWP EFSMPT Sbjct: 483 VRWPQGQQTVSEFSMPT 499 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 719 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 501 Length adjustment: 34 Effective length of query: 466 Effective length of database: 467 Effective search space: 217622 Effective search space used: 217622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory