Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate BWI76_RS05975 BWI76_RS05975 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__Koxy:BWI76_RS05975 Length = 231 Score = 234 bits (597), Expect = 1e-66 Identities = 129/235 (54%), Positives = 169/235 (71%), Gaps = 6/235 (2%) Query: 5 MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVF 64 MLS ++ YG IQ L V + I+ EIVTLIG+NGAGKT+ L + R+T GR+ F Sbjct: 1 MLSARELKVFYGVIQGLKGVDIDIHDREIVTLIGSNGAGKTSTLNGIVNLVRST-GRVNF 59 Query: 65 DDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGF--FAERDQFQERIKWVYE 122 ++DI+ QT +I+R+ +A+VPEGRR+F+ +T+EENL MG + A + ++R+ Y Sbjct: 60 LNEDISRSQTHQIVRKGLALVPEGRRIFTNLTIEENLRMGAYNNLAGFPRLRDRM---YS 116 Query: 123 LFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIEQ 182 LFPRL ERR Q AGTMSGGEQQMLAI RALMS P LL+LDEPSLGLAP I+ ++F TI+Q Sbjct: 117 LFPRLKERRTQMAGTMSGGEQQMLAIARALMSEPVLLMLDEPSLGLAPKIVGELFATIKQ 176 Query: 183 LREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYLGG 237 LRE+ +T+ LVEQNA AL +ADR YVLENG ++LS +LAN ++ YLGG Sbjct: 177 LREENITVLLVEQNATAALTIADRAYVLENGKIMLSGPAAEVLANPEIKRMYLGG 231 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 231 Length adjustment: 23 Effective length of query: 214 Effective length of database: 208 Effective search space: 44512 Effective search space used: 44512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory