Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate BWI76_RS07000 BWI76_RS07000 2-hydroxy-3-oxopropionate reductase
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__Koxy:BWI76_RS07000 Length = 292 Score = 155 bits (391), Expect = 1e-42 Identities = 92/270 (34%), Positives = 144/270 (53%), Gaps = 8/270 (2%) Query: 4 IAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVIS 63 + F+GLG MG PMA L KAGH ++V + P A L++QGAQ +A Q E +E++ Sbjct: 3 LGFIGLGIMGTPMALRLAKAGHALHVTTIGPVAE-ELLKQGAQHLATAEQVAEQSEIIFI 61 Query: 64 MLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVSG 123 M+P V + G+ G ++D S+I+P ++ A+ G LDAPVSG Sbjct: 62 MVPDTPQVADVLFGEHGCAKAALKGKTIVDMSSISPIETKRFAQQVRDLGADYLDAPVSG 121 Query: 124 GVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILMA 183 G GAR GTLS +VGG FAR +P+ + +G+NI G +G GQ K+ N +++ + + Sbjct: 122 GEIGAREGTLSIMVGGDENVFARVKPLFDILGKNITLVGGNGDGQTCKVANQIIVALNIE 181 Query: 184 GTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQVRL 243 +EAL K G DPA + + + + L ++ + + + GF++ L Sbjct: 182 AVSEALVFASKAGADPARVRQALMGGFASSRILEVHG-------ERMLNRTFNPGFKISL 234 Query: 244 MNKDLGLALANAQAVQASTPLGALARNLFS 273 KDL LAL +A+A+ + P A + LF+ Sbjct: 235 HQKDLNLALQSAKALALNLPNTATCQELFN 264 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 292 Length adjustment: 26 Effective length of query: 272 Effective length of database: 266 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory