Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate BWI76_RS05990 BWI76_RS05990 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YXD0 (288 letters) >FitnessBrowser__Koxy:BWI76_RS05990 Length = 299 Score = 157 bits (396), Expect = 4e-43 Identities = 98/289 (33%), Positives = 172/289 (59%), Gaps = 18/289 (6%) Query: 6 IQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNT-----FGVN 60 +Q +VNG+++G + AL A+G T+ YG+LRL NFAH D + +GA+ T F+ + FGV Sbjct: 7 LQQVVNGMSLGGMYALIAIGYTMVYGVLRLINFAHADVMMVGAFTTLFLFSSIGLPFGVA 66 Query: 61 IWLSMIVAVVGTVGVMLLSEKLLWSRMRSIRANSTTLIIISIGLALFLRNGIILIWGGRN 120 ++L++ A+ G G+++ +++ + +R +A+ +++I +IG++ FL N +++GG + Sbjct: 67 VFLTL--ALCGLFGMLI--DRVAYRPLR--QASKISMLITAIGVSFFLENLFNVLFGGSS 120 Query: 121 QNYNLP-ITPALDIFGVKVPQNQLLVLAL-AVLSIGALHYLLQNTKIGKAMRAVADDLDL 178 + ++ P FG + N ++ L VL + A+ +LL T+ G A+RAVA D++ Sbjct: 121 RFFSAPDFFNNTRAFGDVIITNVAWIVPLITVLLLLAILWLLYRTRYGMAIRAVAFDVNT 180 Query: 179 AKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGL-ITAVRPNMGWFLILPLFASVILGGIGN 237 ++ GID ++I + + ++ +LGG Y + + P MG + L FA+ +LGGIG+ Sbjct: 181 VRLMGIDANRIISLVFALGSSLAALGGVFYSISYPTIDPLMGVLIGLKAFAAAVLGGIGS 240 Query: 238 PYGAIAAAFIIGIVQEVST---PFLGSQYKQGVALLIMILVLLIRPKGL 283 GA+ FI+G + V+ P LG YK A + +ILVLL RP G+ Sbjct: 241 VTGAVLGGFILGFTEVVAVALFPELGG-YKDAFAFMFLILVLLFRPVGI 288 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 299 Length adjustment: 26 Effective length of query: 262 Effective length of database: 273 Effective search space: 71526 Effective search space used: 71526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory