Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate BWI76_RS04370 BWI76_RS04370 FldA family protein
Query= SwissProt::A0A0U2X0E4 (443 letters) >FitnessBrowser__Koxy:BWI76_RS04370 Length = 351 Score = 243 bits (621), Expect = 5e-69 Identities = 142/345 (41%), Positives = 200/345 (57%), Gaps = 14/345 (4%) Query: 5 IDTTIYRAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKVAIV 64 I + R GTS+G + LA DLP + +RD L++IMGSGH L+IDG+GGG+ TSKVAI+ Sbjct: 4 IPCVLMRGGTSKGAFLLADDLPKDIQKRDDCLLAIMGSGHELEIDGIGGGSPQTSKVAII 63 Query: 65 SASTQRSEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTCLVR 124 S S E D+DYLF QV + ER VDT PNCGN++ V FAIE GLV+ T VR Sbjct: 64 SQSLSE-EADIDYLFVQVIVNERRVDTTPNCGNMLCAVGGFAIEHGLVEAASPVTR--VR 120 Query: 125 IFNLNSRQASELVIPVYNGRVHYDDIDDMH-MQRPSARVGLRFLDTVGSCTGKLLPTGNA 183 I N+N+ + + +G+V Y+ + + +A V L FL+ G+ +G+L PTGN Sbjct: 121 IRNVNTNTFIDADVQTPDGKVIYEGDSQIDGVPGRAAPVALTFLNAAGAKSGRLFPTGNR 180 Query: 184 SDWIDGLKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRRMGL 243 D D ++V+ ID A+P+V I +G TG E+ + L+ ++ LL LE +R++AG+ MG Sbjct: 181 MDVFDDVRVTCIDMAMPMVVIPAQSLGKTGYESASELDRDSGLLKSLESIRIQAGKAMGF 240 Query: 244 GDVSGSVVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVCEIL 303 GDV+ V+PK LI P + RYF P CH + A+TGAI A A I ++ E+ Sbjct: 241 GDVTNMVIPKPVLISPALSGGSINVRYFMPHNCHKSLAITGAIGLASACIIPKTIANELT 300 Query: 304 SSRASACSASQRRISIEHPSGVLEVGLVP----PENAAQSLVDVA 344 I +EHPSG +EV L PE+ S++ A Sbjct: 301 KLSGDGI------IKVEHPSGGIEVDLSQTTERPEDIRASVIRTA 339 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 351 Length adjustment: 31 Effective length of query: 412 Effective length of database: 320 Effective search space: 131840 Effective search space used: 131840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory