Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate BWI76_RS06690 BWI76_RS06690 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Koxy:BWI76_RS06690 Length = 369 Score = 308 bits (790), Expect = 1e-88 Identities = 174/373 (46%), Positives = 234/373 (62%), Gaps = 10/373 (2%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 M++I + + K + G LH ++L I DGEF V +GPSGCGKST+LRMIAGLE++S G Sbjct: 1 MSNIRLRNVTKRF-GSTVTLHQVNLDIEDGEFAVFVGPSGCGKSTLLRMIAGLEEVSEGE 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 + IG V+ND+ R VAMVFQ+YALYPHM+V +N+ +GL+ K P EI R+V VA Sbjct: 60 VLIGDEVMNDVVPAHRGVAMVFQSYALYPHMTVAENMGYGLKVNKVPKDEIRRQVEMVAK 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 L L LL+RKP+ +SGGQ+QR AI RAI++ P VF+FDEPLSNLDA+LR ++R I +L Sbjct: 120 TLQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPRVFMFDEPLSNLDAELRVEMRLHIAKL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 H L+TT VYVTHDQ+EAMTLAD++++M G++ Q GSP LY P N F AGFIG+P M Sbjct: 180 HHELKTTMVYVTHDQVEAMTLADKIVVMNYGKVEQMGSPMSLYYNPVNKFVAGFIGSPKM 239 Query: 241 NFLSGTVQR-QDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAAS 299 NFL TV Q GQL ++ A S L+ AV L +RP+H+ Sbjct: 240 NFLPATVTAWQPGQLSVKMAQDHNLTLNITTSPLQPGAAVTLGIRPEHLSTDVNIGTVVE 299 Query: 300 LTCPVSVELVEILGADALLTTRC-GDQTLTALVPADRLPQPGATLTLALDQHELHVF--- 355 C E+VE LG + L +C G + L+P D +P +++A D VF Sbjct: 300 FQC----EVVERLGNNTYLFGQCYGHDNVKILLPGDVHFRPWQKISVAFDDRYCMVFDEN 355 Query: 356 DVESGENLSLPDA 368 D+ +++ PDA Sbjct: 356 DLRISADIAAPDA 368 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 369 Length adjustment: 30 Effective length of query: 376 Effective length of database: 339 Effective search space: 127464 Effective search space used: 127464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory