Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS07235 BWI76_RS07235 hypothetical protein
Query= uniprot:A0A1N7UEK0 (335 letters) >FitnessBrowser__Koxy:BWI76_RS07235 Length = 307 Score = 155 bits (391), Expect = 2e-42 Identities = 95/281 (33%), Positives = 149/281 (53%), Gaps = 10/281 (3%) Query: 10 TAALSLLACSIAMAADGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKDGTVQLTVFDGN 69 T SL+AC + K VG ++ F+ +R + KDG V+ V D Sbjct: 6 TVVASLIACMLPAVVMAKDISVGVSMALFDDNFL-TILRTAMQKEMQKDG-VKAQVEDAK 63 Query: 70 YDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNTKVADA---SV 126 D Q Q++N + Q DAI+ P+DT A + A + +I N + + Sbjct: 64 GDVSQQLQQVQNFIGQGVDAIIVNPVDTNAVKPIMDQATKAGIPLIFVNRRPQAQLTDKM 123 Query: 127 PYVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGKHPDIKII 186 YVG+D V GRLQ +A+ +NGKGNV I+ G + + DR KG EV+ K+PDIKI+ Sbjct: 124 AYVGSDSVLAGRLQMEALAKAMNGKGNVAILLGDLANESTRDRTKGVEEVVAKYPDIKIV 183 Query: 187 EKKTANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALKSHGLTSKDVPVTSI 246 +K+TA + R A+ + +W+ + + I + + ND+MA+GA+QAL G + + + Sbjct: 184 QKQTAKFTRNDAVDVVSNWMTS-GEDIQAIASNNDEMAIGALQAL---GKNPNHILIAGV 239 Query: 247 DGMPDAIQAAKKDE-VTTFLQDAQAQSQGALDVALRALAGK 286 DG PDA+Q K + + T QDA+ Q +GA+D A++ G+ Sbjct: 240 DGTPDALQMLKNGKMIATIFQDAKGQGEGAVDAAIKLANGE 280 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 307 Length adjustment: 28 Effective length of query: 307 Effective length of database: 279 Effective search space: 85653 Effective search space used: 85653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory