Align The fructose inducible fructose/xylitol porter, FruI (characterized)
to candidate BWI76_RS24865 BWI76_RS24865 PTS family enzyme IIB'BC, fructose-specific
Query= TCDB::Q1LZ59 (655 letters) >FitnessBrowser__Koxy:BWI76_RS24865 Length = 470 Score = 390 bits (1001), Expect = e-113 Identities = 218/487 (44%), Positives = 295/487 (60%), Gaps = 40/487 (8%) Query: 169 LVAVTACTTGIAHTYMAEEALKKQAAEMGVGIKVETNGASGVGNKLTADDIKRAKGVIIA 228 ++AVT C TGIAHT+MAEEALK A ++ + IKVETNGASGV N +T D+K GVIIA Sbjct: 4 IIAVTGCPTGIAHTFMAEEALKTAAKKLNIEIKVETNGASGVENAITPADLKDIYGVIIA 63 Query: 229 ADKAVEMDRFNGKPLISRPVAEGIKKPEELINIILDGKAEAYVADNSDLSSEASSSEK-- 286 ADK V +RFNG P+I PV E I P +LIN + G+A A +S+ S+EK Sbjct: 64 ADKDVNAERFNGLPVIEVPVKEAIHHPADLINKFISGQA----ARRQGISASDDSTEKYE 119 Query: 287 -AGLGSAFYKHLMSGVSQMLPFVIGGGIMIALSFLIDQFMGVPKSSLSHLGNYHEIAAIF 345 G YKHLMSGVS MLPFV+ GGI+IA+SFL + P S Y+ IAA Sbjct: 120 RESFGRQVYKHLMSGVSNMLPFVVAGGILIAISFLWGIYSADPNSP-----QYNVIAATL 174 Query: 346 NQVGNAAFGFMIPVFAAYIAYSIAEKPGLVAGFVAGSMATTGLAFNKVAFFEFGEKASQA 405 +VG AF M+P+F AYIA+SI+ +PG+VAGFV G + A Sbjct: 175 MKVGQQAFSIMVPIFTAYIAWSISGRPGMVAGFVGGLL---------------------A 213 Query: 406 SLTGIPSGFLGALAGGFLAGGVILVLKKALAFVPRSLEGIKSILLYPLLGVLVTGFLMLF 465 + TG +GFLG + GF AG +L+++ L +PR EG+KSI + PL+GVLV G +M+ Sbjct: 214 NATG--AGFLGGIIAGFAAGYFMLLIRNMLNGLPRQYEGLKSIFIMPLVGVLVIGVMMVL 271 Query: 466 VNIPMAAINTALYNFLGNLSGGSAVLLGLIVGGMMAIDMGGPFNKAAYVFGTSTLTAAAL 525 + P+AAIN A+ N+L +L + +LLG++VG M + D GGP NKAAYV GT L Sbjct: 272 LGQPVAAINNAMMNWLSSLQEANPILLGIVVGAMCSFDFGGPVNKAAYVTGT-----LLL 326 Query: 526 AKGGSVVMASVMAGGMVPPLAVFVATLLFKNKFTQEEHDAGLTNIVMGLSFITEGAIPFG 585 +G MA V A + PPL + +AT F F++EE AG+ N ++G + ITEGAIPF Sbjct: 327 GQGNYFFMAGVSAACITPPLVIALATTFFPKGFSEEERAAGMVNYILGCTHITEGAIPFA 386 Query: 586 AGDPARAIPSFIVGSAVTGALVGLSGIKLMAPHGGIFVIALTSNPLLYLLYIAVGAVIAG 645 A DP R IP ++ S+++ L I++ APHGG ++ L S PL+++L I G+ Sbjct: 387 AKDPLRVIPMMMIASSISAVLSYSLQIQVPAPHGGFLILPLVSKPLMWVLCILAGSACGA 446 Query: 646 ILFGSLR 652 ++ G R Sbjct: 447 VMLGCWR 453 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 762 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 470 Length adjustment: 36 Effective length of query: 619 Effective length of database: 434 Effective search space: 268646 Effective search space used: 268646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory