Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate BWI76_RS23630 BWI76_RS23630 acetoin(diacetyl) reductase
Query= BRENDA::Q8GR61 (262 letters) >FitnessBrowser__Koxy:BWI76_RS23630 Length = 259 Score = 132 bits (332), Expect = 7e-36 Identities = 86/261 (32%), Positives = 137/261 (52%), Gaps = 17/261 (6%) Query: 8 KVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTS 67 KV LVTGAG IG ALRLA++G ++ L+D+N E + A V G +A ++V ++ Sbjct: 6 KVALVTGAGQGIGRGIALRLAKDGASLMLVDVNPEGIAAVAAEVEALGRKAATFVANIAD 65 Query: 68 EEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAV 127 V +D + G D + NNAG A + D ++ R++ INV G ++A Sbjct: 66 RAQVYAAIDEAEKQLGGFDIIVNNAGIAQVQA-LADVTPEEVDRIMRINVQGTLWGIQAA 124 Query: 128 SRQMI-TQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAIS 186 +++ I Q G+I+N S+AG G + Y +K A+ ALT+ AA + A I VNA Sbjct: 125 AKKFIDRQQKGKIINACSIAGHDGFALLGVYSATKFAVRALTQAAAKEYASRGITVNAYC 184 Query: 187 PGYMGPGFMW----ERQVELQ-AKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVV 241 PG +G G MW +R E+ A VG Y ++ + + + R +++ +V Sbjct: 185 PGIVGTG-MWTEIDKRFAEITGAPVGETY---------KKYVEGIALGRAETPDDVASLV 234 Query: 242 AFLLGDDSSFMTGVNLPIAGG 262 ++L G DS ++TG ++ I GG Sbjct: 235 SYLAGPDSDYVTGQSILIDGG 255 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory