Align SDR family oxidoreductase (characterized, see rationale)
to candidate BWI76_RS13720 BWI76_RS13720 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Koxy:BWI76_RS13720 Length = 257 Score = 114 bits (285), Expect = 2e-30 Identities = 95/257 (36%), Positives = 132/257 (51%), Gaps = 16/257 (6%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASI---AGVETHLLDV 63 R + K V IT AAQGIGR + E AREGAR++ D S+ ++ ELA+ +G E L+ Sbjct: 2 RFSNKVVAITGAAQGIGRQTAEQAAREGARLLLIDRSR-YVHELAAALNDSGSEALALEA 60 Query: 64 ------TDDDAIKALVAKVGTVDVLFN-CAGYVAAGNILECDDKAWDFSFNLNAKAMFHT 116 + + A VA G +DVL N G + A E + + + Sbjct: 61 DLEQWESTERAFAEGVAHFGRLDVLINNVGGTIWARPFAEYQPQQIEKEIRRSLFPTLWG 120 Query: 117 IRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRC 176 RA LP ML + GSIVNI+S A++ GV NR Y A+K V LT+S+A ++ + GIR Sbjct: 121 CRAALPWMLRQGKGSIVNISSVATA--GV-NRVPYSAAKGGVNALTRSLALEYSANGIRI 177 Query: 177 NAICPGTIESPS-LNQRISTQ-AKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLA 234 NA+ PG E+P+ L R Q + K +V VA M R G E A L+LA Sbjct: 178 NAVAPGGTEAPARLTPRNEEQPTAQEQKWYQQVVDQTVASSLMHRYGTLAEQANAILFLA 237 Query: 235 SDESNFTTGSIHMIDGG 251 SDE+++ TG + GG Sbjct: 238 SDEASYITGVTLPVAGG 254 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory